COMT antibody (Middle Region)

Catalog No. ABIN635716

This Rabbit Polyclonal antibody specifically detects COMT in WB. It exhibits reactivity toward Human.

Quick Overview for COMT antibody (Middle Region) (ABIN635716)

Target: COMT (Catechol-O-Methyltransferase (COMT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COMT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-COMT Antibody

Binding Specificity: Middle Region

Specificity: COMT antibody was raised against the middle region of COMT

Purification: Affinity purified

Immunogen: COMT antibody was raised using the middle region of COMT corresponding to a region with amino acids PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COMT Blocking Peptide, (ABIN5612959), is also available for use as a blocking control in assays to test for specificity of this COMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COMT

Target: COMT (Catechol-O-Methyltransferase (COMT))

Alternative Name: COMT

Background: Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, SARS-CoV-2 Protein Interactome