SLC39A11 antibody
-
- Target See all SLC39A11 Antibodies
- SLC39A11 (Solute Carrier Family 39 (Metal Ion Transporter), Member 11 (SLC39A11))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC39A11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC39 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARNLAIG
- Top Product
- Discover our top product SLC39A11 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC39A11 Blocking Peptide, catalog no. 33R-3300, is also available for use as a blocking control in assays to test for specificity of this SLC39A11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC39A11 (Solute Carrier Family 39 (Metal Ion Transporter), Member 11 (SLC39A11))
- Alternative Name
- SLC39A11 (SLC39A11 Products)
- Synonyms
- 1810074D23Rik antibody, C17orf26 antibody, ZIP11 antibody, solute carrier family 39 member 11 antibody, solute carrier family 39 (metal ion transporter), member 11 antibody, solute carrier family 39, member 11 antibody, SLC39A11 antibody, slc39a11 antibody, Slc39a11 antibody
- Background
- SLC39A11 belongs to the ZIP transporter family. It is a multi-pass membrane protein. SLC39A11 may act as a zinc-influx transporter.
- Molecular Weight
- 35 kDa (MW of target protein)
-