FKBP11 antibody (N-Term)
-
- Target See all FKBP11 Antibodies
- FKBP11 (FK506 Binding Protein 11, 19 KDa (FKBP11))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FKBP11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FKBP11 antibody was raised against the N terminal of FKBP11
- Purification
- Affinity purified
- Immunogen
- FKBP11 antibody was raised using the N terminal of FKBP11 corresponding to a region with amino acids VRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLV
- Top Product
- Discover our top product FKBP11 Primary Antibody
-
anti-FK506 Binding Protein 11, 19 KDa (FKBP11) (AA 28-154) antibody
FKBP11 Reactivity: Human WB, ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-FK506 Binding Protein 11, 19 KDa (FKBP11) (AA 52-82), (N-Term) antibodyFKBP11 Reactivity: Human, Mouse WB, IHC (p), FACS Host: Rabbit Polyclonal RB19302 unconjugated
anti-FK506 Binding Protein 11, 19 KDa (FKBP11) (AA 159-188), (C-Term) antibodyFKBP11 Reactivity: Human, Mouse WB, IHC (p), FACS Host: Rabbit Polyclonal RB19303 unconjugated
anti-FK506 Binding Protein 11, 19 KDa (FKBP11) (AA 1-201) antibodyFKBP11 Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-FK506 Binding Protein 11, 19 KDa (FKBP11) (AA 1-201) antibodyFKBP11 Reactivity: Human WB Host: Mouse Polyclonal unconjugated
anti-FK506 Binding Protein 11, 19 KDa (FKBP11) antibodyFKBP11 Reactivity: Human, Mouse WB, FACS, IHC Host: Rabbit Polyclonal unconjugated
anti-FK506 Binding Protein 11, 19 KDa (FKBP11) (AA 35-84) antibodyFKBP11 Reactivity: Human, Mouse, Dog, Guinea Pig, Horse, Rabbit, Zebrafish (Danio rerio), Bat, Hamster, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-FK506 Binding Protein 11, 19 KDa (FKBP11) (AA 28-201) antibodyFKBP11 Reactivity: Human WB, ELISA Host: Mouse Monoclonal unconjugated
anti-FK506 Binding Protein 11, 19 KDa (FKBP11) (AA 28-201) antibodyFKBP11 Reactivity: Human WB Host: Mouse Monoclonal 1 unconjugated
anti-FK506 Binding Protein 11, 19 KDa (FKBP11) (AA 52-82) antibodyFKBP11 Reactivity: Human, Mouse WB, IHC (p), FACS, IHC Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FKBP11 Blocking Peptide, catalog no. 33R-9792, is also available for use as a blocking control in assays to test for specificity of this FKBP11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FKBP11 (FK506 Binding Protein 11, 19 KDa (FKBP11))
- Alternative Name
- FKBP11 (FKBP11 Products)
- Synonyms
- MGC85245 antibody, 1110002O23Rik antibody, FKBP-11 antibody, si:dz202l16.2 antibody, wu:fd54d02 antibody, zgc:110640 antibody, FKBP19 antibody, FK506 binding protein 11 L homeolog antibody, FK506 binding protein 11 antibody, fkbp11.L antibody, FKBP11 antibody, Fkbp11 antibody, fkbp11 antibody
- Background
- FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin.
- Molecular Weight
- 19 kDa (MW of target protein)
-
