CHST1 antibody

Catalog No. ABIN635810

The Rabbit Polyclonal anti-CHST1 antibody is suitable to detect CHST1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for CHST1 antibody (ABIN635810)

Target: CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHST1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHST1 Antibody

Purification: Affinity purified

Immunogen: CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHST1 Blocking Peptide, (ABIN936201), is also available for use as a blocking control in assays to test for specificity of this CHST1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHST1

Target: CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))

Alternative Name: CHST1

Background: CHST1 catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process