B3GALTL antibody (Middle Region)

Catalog No. ABIN635816

The Rabbit Polyclonal anti-B3GALTL antibody is suitable to detect B3GALTL in samples from Human. It has been validated for WB.

Quick Overview for B3GALTL antibody (Middle Region) (ABIN635816)

Target: B3GALTL (beta 1,3-Galactosyltransferase-Like (B3GALTL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B3GALTL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-B3GALTL Antibody

Binding Specificity: Middle Region

Specificity: B3 GALTL antibody was raised against the middle region of B3 ALTL

Purification: Affinity purified

Immunogen: B3 GALTL antibody was raised using the middle region of B3 ALTL corresponding to a region with amino acids DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

B3GALTL Blocking Peptide, (ABIN937629), is also available for use as a blocking control in assays to test for specificity of this B3GALTL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALTL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for B3GALTL

Target: B3GALTL (beta 1,3-Galactosyltransferase-Like (B3GALTL))

Alternative Name: B3GALTL

Background: B3GALTL is the O-fucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. B3GALTL specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan.B3GALTL is a beta-1,3-glucosyltransferase involved in the synthesis of the unusual O-linked disaccharide glucosyl-beta-1,3-fucose-O- found on the thrombospondin type-1 repeats (TSRs) of many biologically important proteins.

Molecular Weight: 56 kDa (MW of target protein)