SLC1A1 antibody (N-Term)
-
- Target See all SLC1A1 Antibodies
- SLC1A1 (Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1 (SLC1A1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC1A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC1 A1 antibody was raised against the N terminal Of Slc1 1
- Purification
- Affinity purified
- Immunogen
- SLC1 A1 antibody was raised using the N terminal Of Slc1 1 corresponding to a region with amino acids VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN
- Top Product
- Discover our top product SLC1A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC1A1 Blocking Peptide, catalog no. 33R-9692, is also available for use as a blocking control in assays to test for specificity of this SLC1A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC1A1 (Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1 (SLC1A1))
- Alternative Name
- SLC1A1 (SLC1A1 Products)
- Synonyms
- GB16911 antibody, EAAT3 antibody, SLC1A2a antibody, zgc:91959 antibody, EAAC1 antibody, SCZD18 antibody, D130048G10Rik antibody, EAAC2 antibody, MEAAC1 antibody, Eaac1 antibody, Eaat3 antibody, REAAC1 antibody, excitatory amino acid transporter 3 antibody, solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter, system Xag), member 1 antibody, solute carrier family 1 member 1 antibody, LOC412382 antibody, slc1a1 antibody, SLC1A1 antibody, CpipJ_CPIJ000674 antibody, CpipJ_CPIJ001134 antibody, Slc1a1 antibody
- Background
- SLC1A1 transports L-glutamate and also L- and D-aspartate. It is essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. SLC1A1 acts as a symport by cotransporting sodium. It negatively regulated by ARL6IP5.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-