TMED1 antibody (Middle Region)

Catalog No. ABIN635968

Product Details anti-TMED1 Antibody

Target: TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMED1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMED1 antibody was raised against the middle region of TMED1

Purification: Affinity purified

Immunogen: TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMED1 Blocking Peptide, catalog no. 33R-3095, is also available for use as a blocking control in assays to test for specificity of this TMED1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMED1

Target: TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))

Alternative Name: TMED1 (TMED1 Products)

Synonyms: Il1rl1l antibody, Ly84l antibody, St2l antibody, IL1RL1LG antibody, Tp24 antibody, tmed1 antibody, zgc:92038 antibody, zgc:158680 antibody, transmembrane p24 trafficking protein 1 antibody, transmembrane p24 trafficking protein 1a antibody, transmembrane p24 trafficking protein 1b antibody, Tmed1 antibody, TMED1 antibody, tmed1a antibody, tmed1b antibody

Background: TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.

Molecular Weight: 23 kDa (MW of target protein)