GCNT4 antibody

Catalog No. ABIN635987

Product Details anti-GCNT4 Antibody

Target: GCNT4 (Glucosaminyl (N-Acetyl) Transferase 4, Core 2 (Beta-1,6-N-Acetylglucosaminyltransferase) (GCNT4))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GCNT4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GCNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GCNT4 Blocking Peptide, catalog no. 33R-8548, is also available for use as a blocking control in assays to test for specificity of this GCNT4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCNT4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GCNT4

Target: GCNT4 (Glucosaminyl (N-Acetyl) Transferase 4, Core 2 (Beta-1,6-N-Acetylglucosaminyltransferase) (GCNT4))

Alternative Name: GCNT4 (GCNT4 Products)

Synonyms: C2GNT3 antibody, C2gnt3 antibody, Gm279 antibody, Gm73 antibody, c2gnt3 antibody, gcnt4 antibody, wu:fc31c11 antibody, glucosaminyl (N-acetyl) transferase 4, core 2 antibody, glucosaminyl (N-acetyl) transferase 4, core 2 (beta-1,6-N-acetylglucosaminyltransferase) antibody, glucosaminyl (N-acetyl) transferase 4, core 2, a antibody, GCNT4 antibody, Gcnt4 antibody, gcnt4a antibody

Background: GCNT4 is a glycosyltransferase that mediates core 2 O-glycan branching, an important step in mucin-type biosynthesis. It does not have core 4 O-glycan or I-branching enzyme activity.

Molecular Weight: 53 kDa (MW of target protein)