QPCTL antibody (Middle Region)

Catalog No. ABIN635992

Product Details anti-QPCTL Antibody

Target: QPCTL (Glutaminyl-Peptide Cyclotransferase-Like (QPCTL))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This QPCTL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: QPCTL antibody was raised against the middle region of QPCTL

Purification: Affinity purified

Immunogen: QPCTL antibody was raised using the middle region of QPCTL corresponding to a region with amino acids QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

QPCTL Blocking Peptide, catalog no. 33R-7631, is also available for use as a blocking control in assays to test for specificity of this QPCTL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QPCTL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for QPCTL

Target: QPCTL (Glutaminyl-Peptide Cyclotransferase-Like (QPCTL))

Alternative Name: QPCTL (QPCTL Products)

Synonyms: fb71g05 antibody, si:dkey-149j18.2 antibody, wu:fb71g05 antibody, si:ch211-191j22.6 antibody, gQC antibody, 1810019P04Rik antibody, BB101812 antibody, RGD1308128 antibody, glutaminyl-peptide cyclotransferase-like antibody, glutaminyl-peptide cyclotransferase like antibody, glutaminyl-peptide cyclotransferase-like a antibody, glutaminyl-peptide cyclotransferase-like b antibody, glutaminyl-peptide cyclotransferase antibody, LOC411943 antibody, QPCTL antibody, qpctla antibody, qpctlb antibody, LOC100163689 antibody, qpctl antibody, Qpctl antibody

Background: QPCTL is a single-pass membrane proteinPotential. It belongs to the glutaminyl-peptide cyclotransferase family. The exact function of QPCTL remains unknown.

Molecular Weight: 43 kDa (MW of target protein)