ACVR1C/ALK7 antibody (N-Term)

Catalog No. ABIN636054

The Rabbit Polyclonal anti-ACVR1C/ALK7 antibody (ABIN636054) specifically detects ACVR1C/ALK7 in WB. The antibody is reactive with Human samples.

Quick Overview for ACVR1C/ALK7 antibody (N-Term) (ABIN636054)

Target: ACVR1C/ALK7 (ACVR1C) (Activin Receptor Type 1C (ACVR1C))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACVR1C/ALK7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACVR1C/ALK7 Antibody

Binding Specificity: N-Term

Specificity: ACVR1 C antibody was raised against the N terminal of ACVR1

Purification: Affinity purified

Immunogen: ACVR1 C antibody was raised using the N terminal of ACVR1 corresponding to a region with amino acids QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACVR1C Blocking Peptide, (ABIN5611928), is also available for use as a blocking control in assays to test for specificity of this ACVR1C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACVR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACVR1C/ALK7

Target: ACVR1C/ALK7 (ACVR1C) (Activin Receptor Type 1C (ACVR1C))

Alternative Name: ACVR1C

Background: ACVR1C is a type I receptor for the TGFB family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Positive Regulation of Endopeptidase Activity