UGT1A6 antibody (C-Term)

Catalog No. ABIN636119

Product Details anti-UGT1A6 Antibody

Target: UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6 (UGT1A6))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT1A6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UGT1 A6 antibody was raised against the C terminal of µgT1 6

Purification: Affinity purified

Immunogen: UGT1 A6 antibody was raised using the C terminal of µgT1 6 corresponding to a region with amino acids APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT1A6 Blocking Peptide, catalog no. 33R-1424, is also available for use as a blocking control in assays to test for specificity of this µgT1A6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT1A6

Target: UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6 (UGT1A6))

Alternative Name: UGT1A6 (UGT1A6 Products)

Synonyms: GNT1 antibody, HLUGP antibody, HLUGP1 antibody, UDPGT antibody, UDPGT 1-6 antibody, UGT1 antibody, UGT1A6S antibody, UGT1F antibody, UGT1A10 antibody, UGT1A6 antibody, UGT1A7 antibody, UGT1A8 antibody, UGT1A9 antibody, DKFZP469F071 antibody, UGT1A5 antibody, UGT antibody, Udpgt antibody, Ugt1 antibody, Ugt1a7 antibody, UGT1-06 antibody, UGT1.6 antibody, Ugt1a6b antibody, Ugt1a6 antibody, UDP glucuronosyltransferase family 1 member A6 antibody, UDP glucuronosyltransferase family 1 member A1 antibody, UDP glucuronosyltransferase 1 family, polypeptide A6 antibody, UDP-glucuronosyltransferase 1-1 antibody, UDP glucuronosyltransferase 1 family, polypeptide A6 S homeolog antibody, UDP-glucuronosyltransferase 1-6 antibody, UGT1A6 antibody, UGT1A1 antibody, LOC739942 antibody, ugt1a6.S antibody, ugt1a6 antibody, LOC100481084 antibody, Ugt1a6 antibody, UGT1-6 antibody, LOC100731122 antibody

Background: UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha