NK6 Homeobox 1 (NKX6-1) (N-Term) antibody

Antigen: NK6 Homeobox 1 (NKX6-1)

Synonyms: NKX6A, NKX6.1, Nkx6.1, Nkx61, Nkx6a, nkx6a, nkx6.1

Binding Site: N-Term

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN784751

Additional Information

Alternative name: NKX6-1

Gene ID: NKX6-1

UniProt: P78426

Immunogen: The immunogen for anti-NKX6-1 antibody: synthetic peptide directed towards the N terminal of human NKX6-1

Sequence: MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAY PPLPAGPPSS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NKX6-1 antibody concentration is 1 mg/ml.

Description: NKX6-1 is the transcription factor which binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. NKX6-1 is involved in transcriptional regulation in islet beta cells. Binds to the insulin promoter and is involved in regulation of the insulin gene. Together with NKX2-2 and IRX3, NKX6-1 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. NKX6-1 belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals.In the pancreas, NKX6.1 is required for the development of beta cells and is a potent bifunctional transcription regulator that binds to AT-rich sequences within the promoter region of target genes Iype et al. (2004) [PubMed 15056733].[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-300 U66797.1 1-300 301-307 AC096766.3 119394-119400 c 308-676 U66797.1 308-676 677-849 U66798.1 7-179 850-1116 U66799.1 7-273

Characteristics: Antigen Size: 367 amino acids

Molecular Weight: 38kDa

Application Details

Application Notes: WB Suggested Anti-NKX6-1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-NKX6-1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine

Publications

Product: Schisler, Fueger, Babu et al.: "Stimulation of human and rat islet beta-cell proliferation with retention of function by the homeodomain transcription factor Nkx6.1." in: Molecular and cellular biology, Vol. 28, Issue 10, pp. 3465-76, 2008 (PubMed).