Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN784751

NK6 Homeobox 1 (NKX6-1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NKX6A, NKX6.1, Nkx6.1, Nkx61, Nkx6a, nkx6.1, nkx6a
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN784751
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NKX6-1 antibody: synthetic peptide directed towards the N terminal of human NKX6-1
Sequence MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAY PPLPAGPPSS
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Dog : 100%, Pig : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against NKX6-1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NKX6-1
Background NKX6-1 is the transcription factor which binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. NKX6-1 is involved in transcriptional regulation in islet beta cells. Binds to the insulin promoter and is involved in regulation of the insulin gene. Together with NKX2-2 and IRX3, NKX6-1 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. NKX6-1 belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals.In the pancreas, NKX6.1 is required for the development of beta cells and is a potent bifunctional transcription regulator that binds to AT-rich sequences within the promoter region of target genes Iype et al. (2004) [PubMed 15056733].
Molecular Weight 38kDa
Gene ID 4825
NCBI Accession NP_006159, NM_006168
UniProt P78426
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NKX6-1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Schisler, Fueger, Babu et al.: "Stimulation of human and rat islet beta-cell proliferation with retention of function by the homeodomain transcription factor Nkx6.1." in: Molecular and cellular biology, Vol. 28, Issue 10, pp. 3465-76, 2008 (PubMed).

Alternatives for antigen "NK6 Homeobox 1 (NKX6-1)", type "Antibodies"
Hosts (26), (6), (1)
Reactivities (33), (22), (12)
Applications (18), (11), (10), (9), (2), (1), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (6), (6), (3), (2), (2), (2), (2), (2), (1), (1)
Beacon