Did you know that you can buy products from over 140 different suppliers from us?

NK6 Homeobox 1 (NKX6-1) (N-Term) antibody

Details for Product No. ABIN784751
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms nkx6a, nkx6.1, NKX6.1, NKX6A, zgc:92879, Nkx6.1, Nkx61, Nkx6a
Epitope
N-Term
(13), (10), (6), (6), (6), (5), (3), (2), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
(47), (22), (12)
Host
Rabbit
(34), (12), (1), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(33), (20), (10), (9), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN784751
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NKX6-1
Sequence MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAY PPLPAGPPSS
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Dog : 100 %, Pig : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against NKX6-1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NKX6-1
Background NKX6-1 is the transcription factor which binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. NKX6-1 is involved in transcriptional regulation in islet beta cells. Binds to the insulin promoter and is involved in regulation of the insulin gene. Together with NKX2-2 and IRX3, NKX6-1 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. NKX6-1 belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals.In the pancreas, NKX6.1 is required for the development of beta cells and is a potent bifunctional transcription regulator that binds to AT-rich sequences within the promoter region of target genes Iype et al. (2004) [PubMed 15056733].
Molecular Weight 38 kDa
Gene ID 4825
NCBI Accession NM_006168, NP_006159
UniProt P78426
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 367 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Schisler, Fueger, Babu et al.: "Stimulation of human and rat islet beta-cell proliferation with retention of function by the homeodomain transcription factor Nkx6.1." in: Molecular and cellular biology, Vol. 28, Issue 10, pp. 3465-76, 2008 (PubMed).

Validation Images
back to top