Isoprenoid Synthase Domain Containing (ISPD) (N-Term) antibody

Details for Product No. ABIN786004
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MDDGA7, Nip, 4930579E17Rik, AV040780
Epitope
N-Term
(1), (1)
Reactivity
Human
(2)
Host
Rabbit
(3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3)
Pubmed 1 reference available
Catalog no. ABIN786004
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human hCG_1745121
Sequence MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQ THRSSLHYKP
Predicted Reactivity Human :100 %
Characteristics This is a rabbit polyclonal antibody against hCG_1745121. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name hCG_1745121
Background The specific function of hCG_1745121 is not yet known.
Molecular Weight 44 kDa
Gene ID 729920
NCBI Accession NM_001101417, NP_001094887
UniProt A4D126
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 401 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Isoprenoid Synthase Domain Containing (ISPD) (N-Term) antibody WB Suggested Anti-hCG_1745121 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung
Background publications Venter, Adams, Myers et al.: "The sequence of the human genome." in: Science (New York, N.Y.), Vol. 291, Issue 5507, pp. 1304-51, 2001 (PubMed).

Hosts (3)
Reactivities (2)
Applications (3)
Epitopes (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top