Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN786004

Isoprenoid Synthase Domain Containing (ISPD) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MDDGA7, Nip, 4930579E17Rik, AV040780
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN786004
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-hCG_1745121 antibody: synthetic peptide directed towards the N terminal of human hCG_1745121
Sequence MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQ THRSSLHYKP
Predicted Reactivity Human :100%
Characteristics This is a rabbit polyclonal antibody against hCG_1745121. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name hCG_1745121
Background The specific function of hCG_1745121 is not yet known.
Molecular Weight 44kDa
Gene ID 729920
NCBI Accession NP_001094887, NM_001101417
UniProt A4D126
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-hCG_1745121 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Venter, Adams, Myers et al.: "The sequence of the human genome." in: Science (New York, N.Y.), Vol. 291, Issue 5507, pp. 1304-51, 2001 (PubMed).

Alternatives for antigen "Isoprenoid Synthase Domain Containing (ISPD)", type "Antibodies"
Hosts (5)
Reactivities (4), (3)
Applications (5), (1)
Epitopes (3), (2), (1), (1)
Beacon