Isoprenoid Synthase Domain Containing (ISPD) (N-Term) antibody

Antigen: Isoprenoid Synthase Domain Containing (ISPD)

Synonyms: Nip, FLJ42815, hCG_1745121

Binding Site: N-Term

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN786004

Additional Information

Alternative name: HCG_1745121

Gene ID: hCG_1745121

Immunogen: The immunogen for anti-hCG_1745121 antibody: synthetic peptide directed towards the N terminal of human hCG_1745121

Sequence: MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQ THRSSLHYKP

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-hCG_1745121 antibody concentration is 1 mg/ml.

Description: The specific function of hCG_1745121 is not yet known.

Characteristics: Antigen Size: 401 amino acids

Molecular Weight: 44kDa

Application Details

Application Notes: WB Suggested Anti-hCG_1745121 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-hCG_1745121 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung

Publications

Product: Venter, Adams, Myers et al.: "The sequence of the human genome." in: Science (New York, N.Y.), Vol. 291, Issue 5507, pp. 1304-51, 2001 (PubMed).