You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Chemical Annexin V antibody for Western Blotting

Recommended Annexin V Antibody (supplied by: Log in to see )

Annexin A5 (ANXA5) Antibodies
  • anx
  • anx5
  • ANX V
  • anxa5
  • cb989
  • wu:fa98f06
  • wu:fj10f10
  • MGC89158
  • ANX5
  • ENX2
  • PP4
  • RPRGL3
  • Anx5
  • R74653
  • LC5
  • enx2
  • annexin A5
  • annexin A5b
  • Annexin A5
  • annexin 5
  • annexin A5-like
  • ANXA5
  • anxa5b
  • anxa5
  • LOC100220003
  • LOC100305020
  • LOC100342904
  • Anxa5
  • LOC100521982
This Annexin V antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN630241
$ 388.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.0726016 ABIN630242 WB Rabbit N-Term Log in to see Polyclonal

Similar anti-Annexin V Antibodies

Application / Reactivity Chemical
Western Blotting (WB) 2 Antibodies


Antigen Annexin A5 (ANXA5) Antibodies
Epitope N-Term
(24), (14), (10), (10), (7), (7), (7), (5), (5), (3), (3), (2), (2), (2), (1), (1), (1), (1)
Reactivity Chemical
(214), (79), (58), (16), (8), (7), (6), (6), (5), (3), (2), (1), (1), (1), (1), (1)
Host Rabbit
(152), (90)
Conjugate This Annexin V antibody is un-conjugated
(25), (23), (8), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Western Blotting (WB)
(196), (138), (96), (62), (37), (28), (24), (24), (7), (6), (6), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-Annexin V Antibody

Target Details Annexin V Application Details Handling Images
Specificity Annexin A5 antibody was raised against the N terminal of ANXA5
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
Purification Purified
Immunogen Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE

Target Details Annexin V

Product Details anti-Annexin V Antibody Application Details Handling Images back to top
Alternative Name Annexin A5 (ANXA5 Antibody Abstract)
Target Type Chemical
Background The protein encoded by ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.
Molecular Weight 35 kDa (MW of target protein)
Research Area Cell Biology
Pathways Apoptosis

Application Details

Product Details anti-Annexin V Antibody Target Details Annexin V Handling Images back to top
Application Notes WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Annexin A5 Blocking Peptide, catalog no. 33R-8393, is also available for use as a blocking control in assays to test for specificity of this Annexin A5 antibody

Restrictions For Research Use only


Product Details anti-Annexin V Antibody Target Details Annexin V Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add 100 µL distilled water for a 1 mg/mL concentration of ANXA5 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Product Details anti-Annexin V Antibody Target Details Annexin V Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Annexin V antibody (Annexin A5) (N-Term) (ABIN630241) Annexin A5 antibody used at 1.25 ug/ml to detect target protein.