You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rhesus Monkey FASL antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended FASL Antibody (supplied by: Log in to see )

Antigen
Fas Ligand (TNF Superfamily, Member 6) (FASL) Antibodies
  • ALPS1B
  • APT1LG1
  • Apt1Lg1
  • APTL
  • CD95-L
  • CD95L
  • CD178
  • FAS
  • Fas-L
  • FASL
  • fasl
  • Fasl
  • Faslg
  • FASLG
  • gld
  • TNFRSF6
  • Tnfsf6
  • TNFSF6
  • zgc:162027
Epitope
AA 102-280
29
25
14
12
11
9
8
6
6
5
3
3
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Reactivity
Rhesus Monkey
275
138
65
3
2
1
1
1
1
1
Host
Rabbit
145
127
61
29
12
6
Clonality
Polyclonal
Conjugate
This FASL antibody is un-conjugated
32
26
18
5
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
197
161
86
63
57
49
29
29
17
11
11
11
11
6
3
3
2
2
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN1172030
$ 446.60
Plus shipping costs $45.00

Similar anti-FASL Antibodies

Application / Reactivity Rhesus Monkey
ELISA 2 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunohistochemistry (IHC) 2 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 1 Antibodies
Western Blotting (WB) 3 Antibodies

General

Antigen Fas Ligand (TNF Superfamily, Member 6) (FASL) Antibodies
Epitope AA 102-280
(29), (25), (14), (12), (11), (9), (8), (6), (6), (5), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Rhesus Monkey
(275), (138), (65), (3), (2), (1), (1), (1), (1), (1)
Host Rabbit
(145), (127), (61), (29), (12), (6)
Clonality
Polyclonal
Conjugate This FASL antibody is un-conjugated
(32), (26), (18), (5), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
(197), (161), (86), (63), (57), (49), (29), (29), (17), (11), (11), (11), (11), (6), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-FASL Antibody

Target Details FASL Application Details Handling Images
Sequence MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGS-QLFHLQKEL AELRESTSQK HTASSLEKQI GHPSPPPEKK EQRKVAHLTG KPNSRSMPLE WEDTYGIVLL SGVKYKKGGL VINETGLYFV YSKVYFRGQS CTNLPLSHKV YMRNSKYPQD LVMMEGKMMS YCTTGQMWAH SSYLGAVFNL TSADHLYVNV SELSLVNFEE SQTFFGLYKL
Specificity It has been selected for its ability to recognize FASL in immunohistochemical staining and Western blotting.
Purification Affinity Chromatography
Immunogen Recombinant FASL expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against FASL.
Isotype IgG

Target Details FASL

Product Details anti-FASL Antibody Application Details Handling Images back to top
Antigen
Alternative Name Factor Related Apoptosis Ligand (FASL) (FASL Antibody Abstract)
Pathways Apoptosis, EGFR Signaling Pathway

Application Details

Product Details anti-FASL Antibody Target Details FASL Handling Images back to top
Comment

Content: The quality control contains recombinant FASL (Gln102~Leu280) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2 % SDS, 200 mM NaCl, 50 % glycerol,BPB 0.01 % , NaN3 0.02 % .

Restrictions For Research Use only

Handling

Product Details anti-FASL Antibody Target Details FASL Application Details Images back to top
Format Lyophilized
Concentration 200 µg/mL
Buffer Supplied as solution form in PBS, pH7.4, containing 0.02 % NaN3, 50 % glycerol.
Preservative Sodium azide
Precaution of Use WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
Handling Advice Avoid repeated freeze/thaw cycles
Storage 4 °C
Storage Comment Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.
Expiry Date 12 months

Images

Product Details anti-FASL Antibody Target Details FASL Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-FASL antibody (Fas Ligand (TNF Superfamily, Member 6)) (AA 102-280) (ABIN1172030) anti-Fas Ligand (TNF Superfamily, Member 6) (FASL) (AA 102-280) antibody