You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human C9 antibody for Immunocytochemistry

Recommended C9 Antibody (supplied by: Log in to see )

Antigen
Complement Component C9 (C9) Antibodies
  • LOC100037951
  • LOC100136130
  • complement component C9
  • complement component 9
  • LOC100037951
  • LOC100136130
  • C9
  • c9
Reactivity
Human
81
18
15
2
Host
Rabbit
53
25
4
2
1
Clonality
Polyclonal
Conjugate
This C9 antibody is un-conjugated
4
4
4
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
57
40
38
23
11
6
6
3
3
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4299957
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN4299959 ICC IF WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN1732510 ICC IF IHC (p) WB Rabbit IgG AA 184-411 Log in to see Polyclonal
1 ABIN1866979 ICC IHC IP WB Rabbit IgG AA 22-265 Log in to see Polyclonal
1 ABIN2467264 ICC IF IHC WB Rabbit AA 184-411 Log in to see Polyclonal

Top referenced anti-C9 antibody for Immunocytochemistry

Similar anti-C9 Antibodies

Application / Reactivity Human
ELISA 38 Antibodies
Flow Cytometry (FACS) 1 Antibodies
Immunoassay (IA) 1 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 5 Antibodies
Immunofluorescence (IF) 7 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 23 Antibodies
Immunohistochemistry (IHC) 35 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 12 Antibodies
Immunoprecipitation (IP) 1 Antibodies
Western Blotting (WB) 53 Antibodies

General

Antigen Complement Component C9 (C9) Antibodies
Reactivity Human
(81), (18), (15), (2)
Host Rabbit
(53), (25), (4), (2), (1)
Clonality
Polyclonal
Conjugate This C9 antibody is un-conjugated
(4), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(57), (40), (38), (23), (11), (6), (6), (3), (3), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-C9 Antibody

Target Details C9 Application Details Handling References for anti-C9 Antibody (ABIN4299957) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGK
Isotype IgG

Target Details C9

Product Details anti-C9 Antibody Application Details Handling References for anti-C9 Antibody (ABIN4299957) Images back to top
Antigen
Alternative Name Complement Component C9 (C9 Antibody Abstract)
Background Gene Symbol: C9
Gene ID 735
Pathways Complement System

Application Details

Product Details anti-C9 Antibody Target Details C9 Handling References for anti-C9 Antibody (ABIN4299957) Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000, ImmunofluorescenceFor IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-C9 Antibody Target Details C9 Application Details References for anti-C9 Antibody (ABIN4299957) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-C9 Antibody (ABIN4299957)

Product Details anti-C9 Antibody Target Details C9 Application Details Handling Images back to top
Product cited in:

Neiman, Fredolini, Johansson, Lehtiö, Nygren, Uhlén, Nilsson, Schwenk: "Selectivity analysis of single binder assays used in plasma protein profiling." in: Proteomics, Vol. 13, Issue 23-24, pp. 3406-10, 2013

Images

Product Details anti-C9 Antibody Target Details C9 Application Details Handling References for anti-C9 Antibody (ABIN4299957) back to top
Supplier Images
Immunofluorescence (IF) image for anti-C9 antibody (Complement Component C9) (ABIN4299957) Immunofluorescence: Complement Component C9 Antibody [NBP1-87440] - Staining of human...
Immunohistochemistry (IHC) image for anti-C9 antibody (Complement Component C9) (ABIN4299957) Immunohistochemistry: Complement Component C9 Antibody [NBP1-87440] - Staining of hum...