anti-Human CNTF antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CNTF Antibody (supplied by: Log in to see )

Antigen
Ciliary Neurotrophic Factor (CNTF) Antibodies
  • CNTF
  • HCNTF
  • AI429687
  • GPA
  • ciliary neurotrophic factor
  • ciliary neurotrophic factor-like
  • ZFP91 zinc finger protein
  • CNTF
  • Cntf
  • LOC100885759
  • LOC100518821
  • ZFP91
Reactivity
Human
178
81
51
3
2
2
1
1
1
Host
Rabbit
187
23
17
3
3
Clonality
Polyclonal
Conjugate
This CNTF antibody is un-conjugated
33
14
9
4
4
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
183
127
47
22
14
14
13
9
8
8
7
6
5
4
4
3
2
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4299383
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.36902 ABIN213716 IHC (p) ELISA Biotin Rabbit Log in to see Polyclonal
1 ABIN674229 IF (p) IHC (p) WB Rabbit IgG AA 21-70 Log in to see Polyclonal 1
1 ABIN3042520 IHC (p) WB Rabbit IgG AA 2-200 Log in to see Polyclonal
1 ABIN372161 EIA IHC (p) Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN674238 IHC (p) WB HRP Rabbit IgG AA 21-70 Log in to see Polyclonal
1 ABIN674231 IHC (p) WB Biotin Rabbit IgG AA 21-70 Log in to see Polyclonal
1 ABIN1999327 IHC (p) ELISA Rabbit IgG AA 2-200 Log in to see Polyclonal
1 ABIN2473024 Func IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal 1
1 ABIN1497554 IHC (p) ELISA WB Rabbit Log in to see Polyclonal
1 ABIN2619365 IHC (p) ELISA WB Rabbit IgG AA 2-200 Log in to see Polyclonal
1 ABIN1733101 IHC (p) ELISA Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN3030528 IHC (p) WB Rabbit IgG AA 2-200 Log in to see Polyclonal
1 ABIN1171995 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN5575713 ELISA IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN2769420 IHC (p) IHC ELISA Biotin Rabbit Log in to see Polyclonal

Top referenced anti-CNTF antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-CNTF Antibodies

Application / Reactivity Human
Blocking Antibody (Inhibition) 2 Antibodies
Blocking Peptide (BP) 1 Antibodies
Cellular Assay (CA) 1 Antibodies
Dot Blot (DB) 1 Antibodies
ELISA 85 Antibodies
Enzyme Immunoassay (EIA) 10 Antibodies
Flow Cytometry (FACS) 4 Antibodies
Functional Studies (Func) 3 Antibodies
Immunoassay (IA) 1 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 5 Antibodies
Immunofluorescence (IF) 4 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 34 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 4 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 16 Antibodies
Immunoprecipitation (IP) 6 Antibodies
Immunostaining (ISt) 1 Antibodies

General

Antigen Ciliary Neurotrophic Factor (CNTF) Antibodies
Reactivity Human
(178), (81), (51), (3), (2), (2), (1), (1), (1)
Host Rabbit
(187), (23), (17), (3), (3)
Clonality
Polyclonal
Conjugate This CNTF antibody is un-conjugated
(33), (14), (9), (4), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(183), (127), (47), (22), (14), (14), (13), (9), (8), (8), (7), (6), (5), (4), (4), (3), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-CNTF Antibody

Target Details CNTF Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNK
Isotype IgG

Target Details CNTF

Product Details anti-CNTF Antibody Application Details Handling Images back to top
Antigen
Alternative Name CNTF (CNTF Antibody Abstract)
Background Gene Symbol: CNTF
Gene ID 1270
Research Area Stem Cells
Pathways JAK-STAT Signaling

Application Details

Product Details anti-CNTF Antibody Target Details CNTF Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CNTF Antibody Target Details CNTF Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CNTF Antibody Target Details CNTF Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-CNTF antibody (Ciliary Neurotrophic Factor) (ABIN4299383) Western Blot: CNTF Antibody [NBP1-83277] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-CNTF antibody (Ciliary Neurotrophic Factor) (ABIN4299383) Immunocytochemistry/Immunofluorescence: CNTF Antibody [NBP1-83277] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CNTF antibody (Ciliary Neurotrophic Factor) (ABIN4299383) Immunohistochemistry-Paraffin: CNTF Antibody [NBP1-83277] - Staining of human cerebra...