You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human IL11RA antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended IL11RA Antibody (supplied by: Log in to see )

Antigen
Interleukin 11 Receptor, alpha (IL11RA) Antibodies
  • fi26e06
  • il-11ra
  • wu:fi26e06
  • CRSDA
  • AI314697
  • GP130
  • Il-11ra
  • Il11ra
  • Il11ra2
  • NR1
  • interleukin 11 receptor, alpha
  • Interleukin-11 receptor subunit alpha-like
  • interleukin 11 receptor, alpha chain 1
  • il11ra
  • LOC556326
  • IL11RA
  • Il11ra1
Reactivity
Human
48
32
21
4
4
4
4
2
2
1
1
Host
Rabbit
56
7
Clonality
Polyclonal
Conjugate
This IL11RA antibody is un-conjugated
4
3
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
53
40
17
5
5
4
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4325516
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN4325517 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN721000 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal

Similar anti-IL11RA Antibodies

Application / Reactivity Human
ELISA 28 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 1 Antibodies
Immunohistochemistry (IHC) 12 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 3 Antibodies
Immunoprecipitation (IP) 2 Antibodies
Western Blotting (WB) 41 Antibodies

General

Antigen Interleukin 11 Receptor, alpha (IL11RA) Antibodies
Reactivity Human
(48), (32), (21), (4), (4), (4), (4), (2), (2), (1), (1)
Host Rabbit
(56), (7)
Clonality
Polyclonal
Conjugate This IL11RA antibody is un-conjugated
(4), (3)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(53), (40), (17), (5), (5), (4), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL11RA Antibody

Target Details IL11RA Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: VESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRL
Isotype IgG

Target Details IL11RA

Product Details anti-IL11RA Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL11RA (IL11RA Antibody Abstract)
Background Gene Symbol: IL11RA
Gene ID 3590
UniProt Q14626
Research Area Hematopoietic Progenitors, Cytokines, Innate Immunity, Cancer
Pathways JAK-STAT Signaling, Growth Factor Binding

Application Details

Product Details anti-IL11RA Antibody Target Details IL11RA Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL11RA Antibody Target Details IL11RA Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-IL11RA Antibody Target Details IL11RA Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-IL11RA antibody (Interleukin 11 Receptor, alpha) (ABIN4325516) Immunohistochemistry: IL11RA Antibody [NBP2-31997] - Immunohistochemical staining of ...