You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human MAPK6 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MAPK6 Antibody (supplied by: Log in to see )

Antigen
Mitogen-Activated Protein Kinase 6 (MAPK6) Antibodies
  • ATMAPK6
  • ATMPK6
  • F18O19.10
  • MAP KINASE 6
  • MAP kinase 6
  • MAPK6
  • ERK3
  • ERK6
  • P38GAMMA
  • PRKM12
  • SAPK-3
  • SAPK3
  • HsT17250
  • PRKM6
  • p97MAPK
  • 2610021I23Rik
  • D130053K17Rik
  • Erk3
  • Mapk4
  • Mapk63
  • Prkm4
  • Prkm6
  • SUSERK3
  • MAP kinase 6
  • mitogen-activated protein kinase 12
  • mitogen-activated protein kinase 6
  • MPK6
  • MAPK12
  • MAPK6
  • Mapk6
Reactivity
Human
122
77
62
10
7
6
6
5
5
4
3
2
2
1
1
1
Host
Rabbit
91
25
14
2
Clonality
Polyclonal
Conjugate
This MAPK6 antibody is un-conjugated
4
4
4
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
95
69
36
22
13
12
10
7
3
2
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4309450
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.763539 ABIN1714846 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN3043611 IHC (p) WB Rabbit IgG AA 520-721 Log in to see Polyclonal
1 ABIN1911983 IHC (p) ELISA WB Goat AA 683-694 Log in to see Polyclonal
1 ABIN2879404 IF IHC (p) ELISA WB Rabbit IgG AA 461-510 Log in to see Polyclonal
1 ABIN2742757 IF IHC (p) WB Mouse IgG AA 345-721 Log in to see 5E1
1 ABIN2883750 ELISA IHC (p) WB Rabbit IgG pSer189 Log in to see Polyclonal
1 ABIN2587117 ICC IF IHC (p) WB Rabbit Internal Region Log in to see Polyclonal
1 ABIN1712361 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN2963391 IF IHC (p) ELISA WB Rabbit IgG AA 461-510 Log in to see Polyclonal
1 ABIN1701344 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN2963392 IHC (p) ELISA WB Goat C-Term Log in to see Polyclonal
1 ABIN5507802 IHC (p) Rabbit IgG Center Log in to see Polyclonal

Similar anti-MAPK6 Antibodies

Application / Reactivity Human
ELISA 61 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 10 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 4 Antibodies
Immunofluorescence (IF) 22 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 2 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 37 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 13 Antibodies
Immunoprecipitation (IP) 5 Antibodies
RNA Interference (RNAi) 2 Antibodies
Western Blotting (WB) 86 Antibodies

General

Antigen Mitogen-Activated Protein Kinase 6 (MAPK6) Antibodies
Reactivity Human
(122), (77), (62), (10), (7), (6), (6), (5), (5), (4), (3), (2), (2), (1), (1), (1)
Host Rabbit
(91), (25), (14), (2)
Clonality
Polyclonal
Conjugate This MAPK6 antibody is un-conjugated
(4), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(95), (69), (36), (22), (13), (12), (10), (7), (3), (2), (2), (2), (1), (1)
Supplier Log in to see

Product Details anti-MAPK6 Antibody

Target Details MAPK6 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDCQFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYSTEPCWQYSDHHENKYCDLECSH
Isotype IgG

Target Details MAPK6

Product Details anti-MAPK6 Antibody Application Details Handling Images back to top
Antigen
Alternative Name ERK3/MAPK6 (MAPK6 Antibody Abstract)
Background Gene Symbol: MAPK6
Gene ID 5597
Pathways MAPK Signaling, Neurotrophin Signaling Pathway, Regulation of Muscle Cell Differentiation, Hepatitis C

Application Details

Product Details anti-MAPK6 Antibody Target Details MAPK6 Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500-1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MAPK6 Antibody Target Details MAPK6 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-MAPK6 Antibody Target Details MAPK6 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MAPK6 antibody (Mitogen-Activated Protein Kinase 6) (ABIN4309450) Immunohistochemistry-Paraffin: ERK3/MAPK6 Antibody [NBP1-84806] - Staining of human k...
Western Blotting (WB) image for anti-MAPK6 antibody (Mitogen-Activated Protein Kinase 6) (ABIN4309450) Western Blot: ERK3/MAPK6 Antibody [NBP1-84806] - Lane 1: Marker [kDa] 230, 130, 95, 7...
Immunofluorescence (IF) image for anti-MAPK6 antibody (Mitogen-Activated Protein Kinase 6) (ABIN4309450) Immunocytochemistry/Immunofluorescence: ERK3/MAPK6 Antibody [NBP1-84806] - Staining o...