You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) Checkpoint Kinase 2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Checkpoint Kinase 2 Antibody (supplied by: Log in to see )

Checkpoint Kinase 2 (CHEK2) Antibodies
  • Cds1
  • CDS1
  • CHK-2
  • Chk2
  • CHK2
  • fa66f08
  • hCds1
  • HuCds1
  • HUCDS1
  • LFS2
  • PP1425
  • Rad53
  • RAD53
  • wu:fa66f08
  • zgc:55865
AA 465-498, C-Term
Human, Mouse (Murine), Rat (Rattus)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043811
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.24605742 ABIN498829 IHC (p) Rabbit pThr387 Log in to see Polyclonal
0.24605742 ABIN408359 IHC (p) IHC WB Rabbit IgG pThr68 Log in to see Polyclonal 6
0.24605742 ABIN498830 IHC (p) Rabbit pThr68 Log in to see Polyclonal
0.24605742 ABIN498917 IHC (p) Rabbit Log in to see Polyclonal
0.24605742 ABIN498918 IHC (p) Rabbit Log in to see Polyclonal
0.24605742 ABIN4297966 IHC IHC (p) WB Mouse IgG1 Log in to see 73C175-1-1
0.24605742 ABIN4297977 IHC (p) WB Mouse IgG1 Log in to see 73C175-1-1
0.0008917009 ABIN272011 IHC (p) WB Rabbit pSer379 Log in to see Polyclonal
0.0008917009 ABIN271879 IF IHC (p) WB Rabbit Log in to see Polyclonal
0.0008917009 ABIN265350 IHC (p) WB Rabbit Log in to see Polyclonal
0.0008917009 ABIN703165 IF (p) IHC (p) WB Rabbit IgG AA 50-90, pThr68 Log in to see Polyclonal 1
0.0008917009 ABIN302804 IF IHC (p) WB Rabbit N-Term Log in to see Polyclonal
0.0008917009 ABIN317991 IHC (p) WB Rabbit pThr68 Log in to see Polyclonal
0.0008917009 ABIN685867 IF (p) IHC (p) WB Rabbit IgG AA 120-160 Log in to see Polyclonal
0.0008917009 ABIN2000939 IP IHC (p) WB Rabbit IgG AA 1-546 Log in to see Polyclonal
0.0008917009 ABIN703174 IHC (p) WB HRP Rabbit IgG AA 50-90, pThr68 Log in to see Polyclonal
0.0008917009 ABIN703167 IHC (p) WB Biotin Rabbit IgG AA 50-90, pThr68 Log in to see Polyclonal
0.0008917009 ABIN1733040 IHC (p) ELISA WB Rabbit IgG N-Term Log in to see Polyclonal
0.0008917009 ABIN685869 IHC (p) WB Biotin Rabbit IgG AA 120-160 Log in to see Polyclonal
0.0008917009 ABIN685876 IHC (p) WB HRP Rabbit IgG AA 120-160 Log in to see Polyclonal

Top referenced anti-Checkpoint Kinase 2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-Checkpoint Kinase 2 Antibodies

Application / Reactivity Human Mouse (Murine) Rat (Rattus)
Western Blotting (WB) 363 Antibodies 136 Antibodies 116 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Luminex Assay (LMNX) 2 Antibodies
Immunoprecipitation (IP) 39 Antibodies 6 Antibodies 5 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 76 Antibodies 32 Antibodies 28 Antibodies
Immunohistochemistry (IHC) 128 Antibodies 55 Antibodies 52 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 56 Antibodies 44 Antibodies


Antigen Checkpoint Kinase 2 (CHEK2) Antibodies
Epitope AA 465-498, C-Term
(44), (43), (40), (32), (21), (15), (13), (13), (12), (11), (10), (9), (9), (7), (6), (6), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(456), (185), (166), (10), (9), (8), (8), (7), (3), (1), (1), (1)
Host Rabbit
(331), (129), (8), (1)
Conjugate Un-conjugated
(8), (8), (8), (7), (7), (5), (5), (5), (5), (5), (5), (5), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(372), (128), (125), (82), (75), (56), (47), (40), (25), (6), (5), (2), (1), (1)
Supplier Log in to see

Product details

Target details Application Details Handling Images
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: checkpoint kinase 2
Protein Name: Serine/threonine-protein kinase Chk2
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465-498aa KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL), different from the related mouse sequence by four amino acids.
Isotype IgG

Target details

Product details Application Details Handling Images back to top
Alternative Name CHEK2 (CHEK2 Antibody Abstract)
Background CHK2, a protein kinase that is activated in response to DNA damage, is involved in cell cycle arrest. Mapped on 22q12.1, CHK2 has a potential regulatory region rich in SQ and TQ amino acid pairs. It regulates BRCA1 function after DNA damage by phosphorylating serine-988 of BRCA1. Additionally, CHK2 can be modified by phosphorylation and activated in response to ionizing radiation, and can be also modified in response to hydroxyurea treatment. Furthermore, oligomerization of CHEK2 increases the efficiency of transautophosphorylation, resulting in the release of active CHEK2 monomers that proceed to enforce checkpoint control in irradiated cells. Moreover, CHK2 is a tumor suppressor gene conferring predisposition to sarcoma, breast cancer, and brain tumors, and that their observations provided a link between the central role of p53 inactivation in human cancer and the well-defined G2 checkpoint in yeast. There is a wide expression of small amounts of CHK2 mRNA with larger amounts in human testis, spleen, colon, and peripheral blood leukocytes.
Gene ID 11200
UniProt O96017
Pathways p53 Signaling, Apoptosis, Cell Division Cycle

Application Details

Product details Target details Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only


Product details Target details Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C,4 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Product details Target details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Checkpoint Kinase 2 (CHEK2) (AA 465-498), (C-Term) antibody (ABIN3043811) anti-Checkpoint Kinase 2 (CHEK2) (AA 465-498), (C-Term) antibody
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Checkpoint Kinase 2 (CHEK2) (AA 465-498), (C-Term) antibody (ABIN3043811) anti-Checkpoint Kinase 2 (CHEK2) (AA 465-498), (C-Term) antibody (Image 2)