You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human Peroxiredoxin 1 antibody for Immunofluorescence

Recommended Peroxiredoxin 1 Antibody (supplied by: Log in to see )

Antigen
Peroxiredoxin 1 (PRDX1) Antibodies
  • MGC80194
  • MGC84820
  • PRDX1
  • msp23
  • nkefa
  • pag
  • paga
  • pagb
  • prx-1
  • prx1
  • prxi
  • tdpx2
  • cb58
  • prdx1
  • wu:fq19b09
  • zgc:92891
  • 1274
  • CG1274
  • DPx-4156
  • DPx4156
  • Dmel\\CG1274
  • JafRac2
  • Jafrac-2
  • Prx4156
  • MSP23
  • NKEF-A
  • NKEFA
  • PAG
  • PAGA
  • PAGB
  • PRX1
  • PRXI
  • TDPX2
  • NkefA
  • OSF-3
  • OSF3
  • Paga
  • PrdxI
  • PrxI
  • TDX2
  • TPxA
  • Tdpx2
  • Hbp23
  • hm:zehl0637
  • zgc:110343
  • TPX-2
  • CBP
  • peroxiredoxin 1
  • peroxiredoxin 2
  • thioredoxin peroxidase 2
  • Thioredoxin peroxidase 2
  • peroxiredoxin 1-like
  • phosphoprotein associated with glycosphingolipid microdomains 1
  • prdx1
  • PRDX1
  • prdx2
  • Jafrac2
  • TPx2
  • PY02747
  • BCAN_B0712
  • BMEA_B0682
  • Prdx1
  • LOC100350232
  • PAG1
Reactivity
Human
192
61
56
9
8
6
6
5
4
4
3
3
2
1
1
1
1
Host
Rabbit
105
75
21
Clonality
Polyclonal
Conjugate
This Peroxiredoxin 1 antibody is un-conjugated
13
13
10
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
167
111
49
19
18
13
11
11
5
5
4
3
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4344918
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.292799 ABIN488070 IF IHC (p) WB Rabbit AA 1-146 Log in to see Polyclonal
12.292799 ABIN441016 ICC IF IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
12.292799 ABIN3181182 IF WB Mouse IgG1 Log in to see 8E7
12.292799 ABIN2852665 IC IF WB Mouse Log in to see
1 ABIN467365 ICC IF WB Rabbit AA 19-116 Log in to see Polyclonal
1 ABIN1175814 ICC IF IHC WB FITC Rabbit IgG Log in to see Polyclonal
1 ABIN2333470 IF IHC ELISA WB Rabbit AA 103-116 Log in to see Polyclonal
1 ABIN2879938 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1090005 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN1090004 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN2149628 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal

Top referenced anti-Peroxiredoxin 1 antibody for Immunofluorescence

  • Human Polyclonal Peroxiredoxin 1 Primary Antibody for ICC, IF - ABIN4344918 (3 Publications): OLeary, Terrile, Bajor, Gaj, Hennessy, Mills, Zagozdzon, OConnor, Brennan, Connor, Li, Gonzalez-Angulo, Sun, Pu, Pontén, Uhlén, Jirström, Nowis, Crown, Zagozdzon, Gallagher: Peroxiredoxin-1 protects estrogen receptor α from oxidative stress-induced suppression and is a protein biomarker of favorable prognosis in breast cancer. in Breast cancer research : BCR 2014 (PubMed)

Similar anti-Peroxiredoxin 1 Antibodies

Application / Reactivity Human
ELISA 105 Antibodies
Enzyme Immunoassay (EIA) 3 Antibodies
Flow Cytometry (FACS) 5 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 11 Antibodies
Immunofluorescence (IF) 12 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 4 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 45 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 18 Antibodies
Immunoprecipitation (IP) 16 Antibodies
Western Blotting (WB) 159 Antibodies

General

Antigen Peroxiredoxin 1 (PRDX1) Antibodies
Reactivity Human
(192), (61), (56), (9), (8), (6), (6), (5), (4), (4), (3), (3), (2), (1), (1), (1), (1)
Host Rabbit
(105), (75), (21)
Clonality
Polyclonal
Conjugate This Peroxiredoxin 1 antibody is un-conjugated
(13), (13), (10), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(167), (111), (49), (19), (18), (13), (11), (11), (5), (5), (4), (3)
Pubmed 3 references available
Supplier Log in to see

Product Details anti-Peroxiredoxin 1 Antibody

Target Details Peroxiredoxin 1 Application Details Handling References for anti-Peroxiredoxin 1 Antibody (ABIN4344918) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRL
Isotype IgG

Target Details Peroxiredoxin 1

Product Details anti-Peroxiredoxin 1 Antibody Application Details Handling References for anti-Peroxiredoxin 1 Antibody (ABIN4344918) Images back to top
Antigen
Alternative Name Peroxiredoxin 1 (PRDX1 Antibody Abstract)
Background Gene Symbol: PRDX1
Gene ID 5052
Research Area Oxidative Stress, Cardiovascular, Atherosclerosis
Pathways p53 Signaling, EGFR Signaling Pathway

Application Details

Product Details anti-Peroxiredoxin 1 Antibody Target Details Peroxiredoxin 1 Handling References for anti-Peroxiredoxin 1 Antibody (ABIN4344918) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500Immunohistochemistry retrieval recommended: HIER pH 6, Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Peroxiredoxin 1 Antibody Target Details Peroxiredoxin 1 Application Details References for anti-Peroxiredoxin 1 Antibody (ABIN4344918) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Peroxiredoxin 1 Antibody (ABIN4344918)

Product Details anti-Peroxiredoxin 1 Antibody Target Details Peroxiredoxin 1 Application Details Handling Images back to top
Product cited in:

OLeary, Terrile, Bajor, Gaj, Hennessy, Mills, Zagozdzon, OConnor, Brennan, Connor, Li, Gonzalez-Angulo, Sun, Pu, Pontén, Uhlén, Jirström, Nowis, Crown, Zagozdzon, Gallagher: "Peroxiredoxin-1 protects estrogen receptor α from oxidative stress-induced suppression and is a protein biomarker of favorable prognosis in breast cancer." in: Breast cancer research : BCR, Vol. 16, Issue 4, pp. R79, 2014 (Sample species: Human). Further details: Western Blotting,Immunohistochemistry

Kamper, Ludvigsen, Bendix, Hamilton-Dutoit, Rabinovich, Møller, Nyengaard, Honoré, dAmore: "Proteomic analysis identifies galectin-1 as a predictive biomarker for relapsed/refractory disease in classical Hodgkin lymphoma." in: Blood, Vol. 117, Issue 24, pp. 6638-49, 2011

Dammeyer, Arnér: "Human Protein Atlas of redox systems - what can be learnt?" in: Biochimica et biophysica acta, Vol. 1810, Issue 1, pp. 111-38, 2010

Images

Product Details anti-Peroxiredoxin 1 Antibody Target Details Peroxiredoxin 1 Application Details Handling References for anti-Peroxiredoxin 1 Antibody (ABIN4344918) back to top
Supplier Images
Western Blotting (WB) image for anti-Peroxiredoxin 1 antibody (PRDX1) (ABIN4344918) Western Blot: Peroxiredoxin 1 Antibody [NBP1-82558] - Lane 1: Marker [kDa] 230, 130, ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Peroxiredoxin 1 antibody (PRDX1) (ABIN4344918) Immunohistochemistry-Paraffin: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of hu...
Immunofluorescence (IF) image for anti-Peroxiredoxin 1 antibody (PRDX1) (ABIN4344918) Immunocytochemistry/Immunofluorescence: Peroxiredoxin 1 Antibody [NBP1-82558] - Stain...