anti-Human Peroxiredoxin 1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Peroxiredoxin 1 Antibody (supplied by: Log in to see )

Antigen
Peroxiredoxin 1 (PRDX1) Antibodies
  • MGC80194
  • MGC84820
  • PRDX1
  • msp23
  • nkefa
  • pag
  • paga
  • pagb
  • prx-1
  • prx1
  • prxi
  • tdpx2
  • cb58
  • prdx1
  • wu:fq19b09
  • zgc:92891
  • 1274
  • CG1274
  • DPx-4156
  • DPx4156
  • Dmel\\CG1274
  • JafRac2
  • Jafrac-2
  • Prx4156
  • MSP23
  • NKEF-A
  • NKEFA
  • PAG
  • PAGA
  • PAGB
  • PRX1
  • PRXI
  • TDPX2
  • NkefA
  • OSF-3
  • OSF3
  • Paga
  • PrdxI
  • PrxI
  • TDX2
  • TPxA
  • Tdpx2
  • Hbp23
  • hm:zehl0637
  • zgc:110343
  • TPX-2
  • CBP
  • peroxiredoxin 1
  • peroxiredoxin 2
  • thioredoxin peroxidase 2
  • Thioredoxin peroxidase 2
  • peroxiredoxin 1-like
  • phosphoprotein associated with glycosphingolipid microdomains 1
  • prdx1
  • PRDX1
  • prdx2
  • Jafrac2
  • TPx2
  • PY02747
  • BCAN_B0712
  • BMEA_B0682
  • Prdx1
  • LOC100350232
  • PAG1
Reactivity
Human
199
61
56
8
7
6
6
5
4
4
4
3
1
1
1
1
1
Host
Rabbit
107
78
23
Clonality
Polyclonal
Conjugate
This Peroxiredoxin 1 antibody is un-conjugated
13
13
9
4
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
168
105
51
20
20
15
14
13
9
5
5
4
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4344918
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.875275 ABIN615447 EIA IHC (p) WB Goat Internal Region Log in to see Polyclonal
13.875275 ABIN488070 IF IHC (p) WB Rabbit AA 1-146 Log in to see Polyclonal
13.875275 ABIN441016 ICC IF IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN3043903 ICC IHC (p) WB Rabbit IgG AA 100-128, Middle Region Log in to see Polyclonal
1 ABIN750478 IF (p) IHC (p) WB Rabbit IgG AA 63-88 Log in to see Polyclonal 2
1 ABIN389467 FACS IHC (p) WB Rabbit Ig AA 88-116, Center Log in to see Polyclonal
1 ABIN490015 IHC (p) ELISA WB Goat AA 106-117 Log in to see Polyclonal
1 ABIN957795 IHC (p) IP ELISA WB Mouse IgG1, kappa Log in to see
1 ABIN604884 IHC (p) WB Rabbit AA 1-184 Log in to see Polyclonal
1 ABIN1738319 IHC (p) ELISA WB Goat Internal Region Log in to see Polyclonal
1 ABIN2743785 ICC IHC (p) WB Rabbit IgG AA 100-128 Log in to see Polyclonal
1 ABIN750487 IHC (p) WB HRP Rabbit IgG AA 63-88 Log in to see Polyclonal
1 ABIN5531884 FACS IHC (p) WB Rabbit Ig Fraction AA 88-116 Log in to see Polyclonal
1 ABIN750480 IHC (p) WB Biotin Rabbit IgG AA 63-88 Log in to see Polyclonal
1 ABIN1724475 IHC (p) IP ELISA WB Mouse IgG1 kappa Log in to see
1 ABIN3028921 ICC IHC (p) WB Rabbit IgG Middle Region Log in to see Polyclonal
1 ABIN5557512 IF (cc) IHC (p) WB Rabbit IgG Log in to see 7A1
1 ABIN1809993 FACS IHC (p) WB Rabbit AA 88-116 Log in to see Polyclonal
1 ABIN2771569 IHC (p) IHC ELISA WB Goat Internal Region Log in to see Polyclonal

Top referenced anti-Peroxiredoxin 1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-Peroxiredoxin 1 Antibodies

Application / Reactivity Human
ELISA 99 Antibodies
Enzyme Immunoassay (EIA) 5 Antibodies
Flow Cytometry (FACS) 9 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 15 Antibodies
Immunofluorescence (IF) 15 Antibodies
Immunofluorescence (Cultured Cells) (IF (cc)) 1 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 4 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 47 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 20 Antibodies
Immunoprecipitation (IP) 17 Antibodies
Western Blotting (WB) 160 Antibodies

General

Antigen Peroxiredoxin 1 (PRDX1) Antibodies
Reactivity Human
(199), (61), (56), (8), (7), (6), (6), (5), (4), (4), (4), (3), (1), (1), (1), (1), (1)
Host Rabbit
(107), (78), (23)
Clonality
Polyclonal
Conjugate This Peroxiredoxin 1 antibody is un-conjugated
(13), (13), (9), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(168), (105), (51), (20), (20), (15), (14), (13), (9), (5), (5), (4), (2), (1)
Pubmed 3 references available
Supplier Log in to see

Product Details anti-Peroxiredoxin 1 Antibody

Target Details Peroxiredoxin 1 Application Details Handling ProductDetails: References for anti-Peroxiredoxin 1 antibody (ABIN4344918) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRL
Isotype IgG

Target Details Peroxiredoxin 1

Product Details anti-Peroxiredoxin 1 Antibody Application Details Handling ProductDetails: References for anti-Peroxiredoxin 1 antibody (ABIN4344918) Images back to top
Antigen
Alternative Name Peroxiredoxin 1 (PRDX1 Antibody Abstract)
Background Gene Symbol: PRDX1
Gene ID 5052
Research Area Oxidative Stress, Cardiovascular, Atherosclerosis
Pathways p53 Signaling, EGFR Signaling Pathway, CXCR4-mediated Signaling Events

Application Details

Product Details anti-Peroxiredoxin 1 Antibody Target Details Peroxiredoxin 1 Handling ProductDetails: References for anti-Peroxiredoxin 1 antibody (ABIN4344918) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500Immunohistochemistry retrieval recommended: HIER pH 6, Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Peroxiredoxin 1 Antibody Target Details Peroxiredoxin 1 Application Details ProductDetails: References for anti-Peroxiredoxin 1 antibody (ABIN4344918) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-Peroxiredoxin 1 antibody (ABIN4344918)

Product Details anti-Peroxiredoxin 1 Antibody Target Details Peroxiredoxin 1 Application Details Handling Images back to top
Product cited in:

OLeary, Terrile, Bajor, Gaj, Hennessy, Mills, Zagozdzon, OConnor, Brennan, Connor, Li, Gonzalez-Angulo, Sun, Pu, Pontén, Uhlén, Jirström, Nowis, Crown, Zagozdzon, Gallagher: "Peroxiredoxin-1 protects estrogen receptor α from oxidative stress-induced suppression and is a protein biomarker of favorable prognosis in breast cancer." in: Breast cancer research : BCR, Vol. 16, Issue 4, pp. R79, 2014 (Sample species: Human). Further details: Western Blotting,Immunohistochemistry

Kamper, Ludvigsen, Bendix, Hamilton-Dutoit, Rabinovich, Møller, Nyengaard, Honoré, dAmore: "Proteomic analysis identifies galectin-1 as a predictive biomarker for relapsed/refractory disease in classical Hodgkin lymphoma." in: Blood, Vol. 117, Issue 24, pp. 6638-49, 2011

Dammeyer, Arnér: "Human Protein Atlas of redox systems - what can be learnt?" in: Biochimica et biophysica acta, Vol. 1810, Issue 1, pp. 111-38, 2010

Images

Product Details anti-Peroxiredoxin 1 Antibody Target Details Peroxiredoxin 1 Application Details Handling ProductDetails: References for anti-Peroxiredoxin 1 antibody (ABIN4344918) back to top
Supplier Images
Western Blotting (WB) image for anti-Peroxiredoxin 1 antibody (PRDX1) (ABIN4344918) Western Blot: Peroxiredoxin 1 Antibody [NBP1-82558] - Lane 1: Marker [kDa] 230, 130, ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Peroxiredoxin 1 antibody (PRDX1) (ABIN4344918) Immunohistochemistry-Paraffin: Peroxiredoxin 1 Antibody [NBP1-82558] - Staining of hu...
Immunofluorescence (IF) image for anti-Peroxiredoxin 1 antibody (PRDX1) (ABIN4344918) Immunocytochemistry/Immunofluorescence: Peroxiredoxin 1 Antibody [NBP1-82558] - Stain...