Did you know that you can buy products from over 140 different suppliers from us?

Anaphase Promoting Complex Subunit 5 (ANAPC5) (AA 2-232), (partial) protein (GST tag)

Details for Product No. ABIN1046520
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms DDBDRAFT_0206386, DDBDRAFT_0234269, DDB_0206386, DDB_0234269, zgc:55800, wu:fb75a09, ANAPC5, MGC89697, APC5, 2510006G12Rik, AA408751, AA536819, AA986414, Anpc5, F12K11.7, F12K11_7
Protein Characteristics
AA 2-232, partial
Origin
Human
(6), (1)
Source
Escherichia coli (E. coli)
(3), (2), (2)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 5 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 9 to 11 Business Days
Catalog No. ABIN1046520
242.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence ASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLL NEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKL IEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSG TEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQY FQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEV SCSGPLSQKQAEFFLSQQASLLKNDETKALT
Characteristics Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Ref.7
Purity 90%
Alternative Name Anaphase-promoting complex subunit 5
Background Synonyms: APC5,Cyclosome subunit 5
Molecular Weight 53.6 kD
UniProt Q9UJX4
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Yu, Peters, King et al.: "Identification of a cullin homology region in a subunit of the anaphase-promoting complex." in: Science (New York, N.Y.), Vol. 279, Issue 5354, pp. 1219-22, 1998 (PubMed).

Kraft, Herzog, Gieffers et al.: "Mitotic regulation of the human anaphase-promoting complex by phosphorylation." in: The EMBO journal, Vol. 22, Issue 24, pp. 6598-609, 2003 (PubMed).

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Bechtel, Rosenfelder, Duda et al.: "The full-ORF clone resource of the German cDNA Consortium." in: BMC genomics, Vol. 8, pp. 399, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN1046520
242.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top