KIAA0494 (KIAA0494) (AA 1-483), (partial) protein (GST tag)

Details for Product No. ABIN1046959
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms MGC80252, KIAA0494, DKFZp468F099, RP11-8J9.3, 4732418C07Rik
Protein Characteristics
AA 1-483, partial
Origin
Human
(6)
Source
Escherichia coli (E. coli)
(3), (2), (1)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 3 references available
Quantity 200 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 9 to 11 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN1046959
687.50 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence MKKRKELNALIGLAGDSRRKKPKKGPSSHRLLRTEPPDSD SESSSEEEEEFGVVGNRSRFAKGDYLRCCKICYPLCGFVI LAACVVACVGLVWMQVALKEDLDALKEKFRTMESNQKSSF QEIPKLNEELLSKQKQLEKIESGEMGLNKVWINITEMNKQ ISLLTSAVNHLKANVKSAADLISLPTTVEGLQKSVASIGN TLNSVHLAVEALQKTVDEHKKTMELLQSDMNQHFLKETPG SNQIIPSPSATSELDNKTHSENLKQDILYLHNSLEEVNSA LVGYQRQNDLKLEGMNETVSNLTQRVNLIESDVVAMSKVE KKANLSFSMMGDRSATLKRQSLDQVTNRTDTVKIQSIKKE DSSNSQVSKLREKLQLISALTNKPESNRPPETADEEQVES FTSKPSALPKFSQFLGDPVEKAAQLRPISLPGVSSTEDLQ DLFRKTGQDVDGKLTYQEIWTSLGSAMPEPESLRAFDSDG DGR
Characteristics calcium ion binding
Purity 90 %
Alternative Name EF-hand domain-containing protein KIAA0494
Molecular Weight 81 kD
UniProt O75071
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Seki, Ohira, Nagase et al.: "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 4, Issue 5, pp. 345-9, 1998 (PubMed).

Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Daub, Olsen, Bairlein et al.: "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." in: Molecular cell, Vol. 31, Issue 3, pp. 438-48, 2008 (PubMed).

Validation Images
back to top