Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1046959

KIAA0494 (KIAA0494) protein (GST tag)

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms KIAA0494, RP11-8J9.3, 4732418C07Rik, MGC80252, DKFZp468F099
Origin
»Alternatives Human
Source
»Alternatives Escherichia coli (E. coli)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 3 references available
Catalog no. ABIN1046959
Quantity 200 µg
Price
687.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 9 to 11 Business Days
Sequence MKKRKELNALIGLAGDSRRKKPKKGPSSHRLLRTEPPDSD SESSSEEEEEFGVVGNRSRFAKGDYLRCCKICYPLCGFVI LAACVVACVGLVWMQVALKEDLDALKEKFRTMESNQKSSF QEIPKLNEELLSKQKQLEKIESGEMGLNKVWINITEMNKQ ISLLTSAVNHLKANVKSAADLISLPTTVEGLQKSVASIGN TLNSVHLAVEALQKTVDEHKKTMELLQSDMNQHFLKETPG SNQIIPSPSATSELDNKTHSENLKQDILYLHNSLEEVNSA LVGYQRQNDLKLEGMNETVSNLTQRVNLIESDVVAMSKVE KKANLSFSMMGDRSATLKRQSLDQVTNRTDTVKIQSIKKE DSSNSQVSKLREKLQLISALTNKPESNRPPETADEEQVESFTSKPSALPKFSQFLGDPVEKAAQLRPISLPGVSSTEDLQDLFRKTGQDVDGKLTYQEIWTSLGSAMPEPESLRAFDSDGDGR
Characteristics calcium ion binding
Purity 90%
Alternative Name EF-hand domain-containing protein KIAA0494
Molecular Weight 80 kDa
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Seki, Ohira, Nagase et al.: "Characterization of cDNA clones in size-fractionated cDNA libraries from human brain." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 4, Issue 5, pp. 345-9, 1998 (PubMed).

Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Daub, Olsen, Bairlein et al.: "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." in: Molecular cell, Vol. 31, Issue 3, pp. 438-48, 2008 (PubMed).

Alternatives for antigen "KIAA0494 (KIAA0494)", type "Proteins"
Hosts (4), (1)
Reactivities (7)
Beacon