Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1047769

Transmembrane Emp24 Protein Transport Domain Containing 9 (TMED9) protein (GST tag)

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms GMP25, HSGP25L2G, p25, 2400003B06Rik, RGD1307627
Origin
»Alternatives Human
Source
»Alternatives Escherichia coli (E. coli)
Protein Type Recombinant
Purification tag / Conjugate
GST tag
Application
SDS-PAGE (SDS), ELISA
Pubmed 2 references available
Catalog no. ABIN1047769
Quantity 10 µg
Price
327.80 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 9 to 11 Business Days
Sequence FHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPA TPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQ ICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKD KLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSE
Characteristics Belongs to the EMP24/GP25L family.
Purity 90%
Alternative Name Transmembrane emp24 domain-containing protein 9
Background Synonyms: Glycoprotein 25L2
Molecular Weight 44 kDa
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Restrictions For Research Use only
Buffer PBS buffer, 20mM GSH
Storage -20 °C
Product cited in: Schmutz, Martin, Terry et al.: "The DNA sequence and comparative analysis of human chromosome 5." in: Nature, Vol. 431, Issue 7006, pp. 268-74, 2004 (PubMed).

Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Alternatives for antigen "Transmembrane Emp24 Protein Transport Domain Containing 9 (TMED9)", type "Proteins"
Hosts (3), (3)
Reactivities (6), (1), (1)
Beacon