Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag)

Details for Product No. ABIN3077209, Supplier: Log in to see
Protein Name
  • CG12117
  • Dmel\\CG12117
  • SR
  • sptr
  • DDBDRAFT_0188686
  • DDBDRAFT_0191275
  • DDB_0188686
  • DDB_0191275
  • xspr
  • AA409688
  • ENSMUSG00000071345
  • Gm10328
  • SDR38C1
  • NK1R
  • NKIR
  • SPR
  • TAC1R
  • Tac1r
  • Sepiapterin reductase
  • sepiapterin reductase
  • sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
  • tachykinin receptor 1
  • Sptr
  • sprE
  • CpipJ_CPIJ000511
  • sr
  • spr
  • spre
  • Spr
  • SPR
  • TACR1
  • Tacr1
Protein Characteristics
AA 1-261
6
2
1
1
1
1
1
Origin
Human
10
2
1
1
1
1
1
Source
Escherichia coli (E. coli)
5
4
2
1
1
Protein Type
Recombinant
Purification tag / Conjugate
His tag
Application
Crystallization (Crys), ELISA, SDS-PAGE (SDS), Western Blotting (WB)
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Sequence MHHHHHHEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
Sequence including N-terminal His-tag.
Characteristics
  • Made in Germany - from design to production - by highly experienced protein experts.
  • Human SPR Protein (raised in E. Coli) purified by multi-step, protein-specific process to ensure crystallization grade.
  • State-of-the-art algorithm used for plasmid design (Gene synthesis).
Purification Two step purification of proteins expressed in bacterial culture:
  1. In a first purification step, the protein is purified from the cleared cell lysate using three different His-tag capture materials: high yield, EDTA resistant, or DTT resistant. Eluate fractions are analyzed by SDS-PAGE.
  2. Protein containing fractions of the best purification are subjected to second purification step through size exclusion chromatography. Eluate fractions are analyzed by SDS-PAGE and Western blot.
Purity >95 % as determined by SDS PAGE, Size Exclusion Chromatography and Western Blot.
Sterility 0.22 μm filtered
Endotoxin Level Endotoxin has not been removed. Please contact us if you require endotoxin removal.
Grade Crystallography grade
Background Catalyzes the final one or two reductions in tetra-hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin.
Molecular Weight 29.0 kDa Including tag.
UniProt P35270
Research Area Metabolism, Neurology
Pathways Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour, Smooth Muscle Cell Migration
Application Notes In addition to the applications listed above we expect the protein to work for functional studies as well. As the protein has not been tested for functional studies yet we cannot offer a guarantee though.
Comment

In cases in which it is highly likely that the recombinant protein with the default tag will be insoluble our protein lab may suggest a higher molecular weight tag (e.g. GST-tag) instead to increase solubility. We will discuss all possible options with you in detail to assure that you receive your protein of interest.

Restrictions For Research Use only
Format Liquid
Buffer 100 mM NaCL, 20 mM Hepes, 10% glycerol. pH value is at the discretion of the manufacturer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -80 °C
Storage Comment Store at -80°C.
Expiry Date Unlimited (if stored properly)
Supplier Images
 image for Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (ABIN3077209) „Crystallography Grade“ protein due to multi-step, protein-specific purification process
 image for Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (ABIN3077209) Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (Image 2)
 image for Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (ABIN3077209) Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (Image 3)