You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) FGFR4 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended FGFR4 Antibody (supplied by: Log in to see )

Fibroblast Growth Factor Receptor 4 (FGFR4) Antibodies
  • cd334
  • CD334
  • etID309818.21
  • Fgfr-4
  • fgfr-4
  • fgfr-4c
  • fgfr4
  • FGFR4
  • JTK2
  • jtk2
  • tkf
  • TKF
  • wu:fc13h10
  • XFGFR-4
  • XFGFR-4a
  • xfgfr4
  • zgc:111935
Human, Mouse (Murine)
This FGFR4 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4311566
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.000899519 ABIN2856017 IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
0.000899519 ABIN671766 FACS IF (p) IHC (p) WB Rabbit IgG AA 40-90 Log in to see Polyclonal
0.000899519 ABIN671775 IHC (p) WB HRP Rabbit IgG AA 40-90 Log in to see Polyclonal
0.000899519 ABIN671768 IHC (p) WB Biotin Rabbit IgG AA 40-90 Log in to see Polyclonal

Similar anti-FGFR4 Antibodies

Application / Reactivity Mouse (Murine) Human
ELISA 17 Antibodies 84 Antibodies
Flow Cytometry (FACS) 12 Antibodies 42 Antibodies
Immunofluorescence (IF) 1 Antibodies 22 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 12 Antibodies 12 Antibodies
Immunohistochemistry (IHC) 5 Antibodies 44 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 5 Antibodies 30 Antibodies
Immunoprecipitation (IP) 4 Antibodies
Western Blotting (WB) 27 Antibodies
Enzyme Immunoassay (EIA) 7 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 8 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 5 Antibodies


Antigen Fibroblast Growth Factor Receptor 4 (FGFR4) Antibodies
Reactivity Human, Mouse (Murine)
(174), (42), (35), (2), (1), (1)
Host Rabbit
(104), (69), (10), (1)
Conjugate This FGFR4 antibody is un-conjugated
(7), (7), (6), (4), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(141), (88), (45), (42), (30), (22), (12), (8), (7), (5), (5), (1), (1)
Supplier Log in to see

Product Details anti-FGFR4 Antibody

Target Details FGFR4 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLP
Isotype IgG

Target Details FGFR4

Product Details anti-FGFR4 Antibody Application Details Handling Images back to top
Alternative Name FGF R4 (FGFR4 Antibody Abstract)
Background Gene Symbol: FGFR4
Pathways RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-FGFR4 Antibody Target Details FGFR4 Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-FGFR4 Antibody Target Details FGFR4 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-FGFR4 Antibody Target Details FGFR4 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-FGFR4 antibody (Fibroblast Growth Factor Receptor 4) (ABIN4311566) Western Blot: FGF R4 Antibody [NBP1-84585] - Lane 1: Marker [kDa] 230, 130, 95, 72, 5...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-FGFR4 antibody (Fibroblast Growth Factor Receptor 4) (ABIN4311566) Immunohistochemistry-Paraffin: FGF R4 Antibody [NBP1-84585] - Staining of human gall ...
Western Blotting (WB) image for anti-FGFR4 antibody (Fibroblast Growth Factor Receptor 4) (ABIN4311566) Western Blot: FGF R4 Antibody [NBP1-84585] - Lane 1: NIH-3T3 cell lysate (Mouse embry...