You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) CD3D antibody for Immunochromatography

Recommended CD3D Antibody (supplied by: Log in to see )

Antigen
CD3d Molecule, delta (CD3-TCR Complex) (CD3D) Antibodies
  • CD3-DELTA
  • T3D
  • T3d
Epitope
AA 22-104
12
6
5
5
5
4
4
4
3
1
1
1
1
Reactivity
Rat (Rattus)
51
20
11
5
5
3
2
Host
Rabbit
59
23
1
Clonality
Polyclonal
Conjugate
This CD3D antibody is un-conjugated
12
11
1
1
Application
Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
51
42
14
12
7
7
7
6
5
4
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN2225817
$ 578.29
Plus shipping costs $45.00

Similar anti-CD3D Antibodies

Application / Reactivity Rat (Rattus)
ELISA 10 Antibodies
Flow Cytometry (FACS) 8 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 3 Antibodies
Immunohistochemistry (IHC) 5 Antibodies
Immunohistochemistry (Acetone-fixed) (IHC (af)) 2 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 2 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 2 Antibodies
Immunoprecipitation (IP) 3 Antibodies
Western Blotting (WB) 10 Antibodies

General

Antigen CD3d Molecule, delta (CD3-TCR Complex) (CD3D) Antibodies
Epitope AA 22-104
(12), (6), (5), (5), (5), (4), (4), (4), (3), (1), (1), (1), (1)
Reactivity Rat (Rattus)
(51), (20), (11), (5), (5), (3), (2)
Host Rabbit
(59), (23), (1)
Clonality
Polyclonal
Conjugate This CD3D antibody is un-conjugated
(12), (11), (1), (1)
Application Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
(51), (42), (14), (12), (7), (7), (7), (6), (5), (4), (2), (2), (2), (1)
Supplier Log in to see

Product Details anti-CD3D Antibody

Target Details CD3D Application Details Handling Images
Sequence MGHHHHHHSG SEF-FKIQVTEYED KVFVTCNTSV MHLDGTVEGW FAKNKTLNLG KGVLDPRGIY LCNGTEQLAK VVSSVQVHYR MCQNCVELDS GTM
Cross-Reactivity Rat (Rattus)
Cross-Reactivity (Details) Calculated cross reactivity: Rt
Characteristics CD3D (T-cell Surface Glycoprotein CD3 delta Chain, T-cell Receptor T3 delta Chain, CD3d, T3D)
Purification Purified by immunoaffinity chromatography.
Immunogen CD3d (Phe22~Met104), MGHHHHHHSGSEF-FKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTM
Isotype IgG

Target Details CD3D

Product Details anti-CD3D Antibody Application Details Handling Images back to top
Antigen
Alternative Name CD3D (CD3D Antibody Abstract)
Pathways TCR Signaling

Application Details

Product Details anti-CD3D Antibody Target Details CD3D Handling Images back to top
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only

Handling

Product Details anti-CD3D Antibody Target Details CD3D Application Details Images back to top
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.05 % sodium azide, 50 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C