You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) DBNL antibody for Immunohistochemistry

Recommended DBNL Antibody (supplied by: Log in to see )

Antigen
Drebrin-Like (DBNL) Antibodies
  • wu:fb34f02
  • zgc:91835
  • dbnl
  • zgc:112450
  • DBNL
  • DKFZp459C0939
  • ABP1
  • HIP-55
  • HIP55
  • SH3P7
  • Abp1
  • mAbp1
  • Sh3p7
  • abp1
  • dbnl-B
  • drebrin-like
  • drebrin-like a
  • drebrin-like b
  • DBNL
  • dbnla
  • dbnlb
  • LOC100148204
  • LOC100357485
  • LOC100412551
  • LOC100474751
  • LOC100621245
  • LOC100626719
  • Dbnl
  • dbnl
Reactivity
Human, Mouse (Murine), Rat (Rattus)
57
16
9
3
2
1
1
1
1
Host
Rabbit
35
16
6
Clonality
Polyclonal
Conjugate
This DBNL antibody is un-conjugated
3
3
3
3
3
3
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
49
32
12
9
4
3
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4317498
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN4317499 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN1872204 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1085415 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN1085416 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN2983325 ICC IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2926736 ELISA IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal

Similar anti-DBNL Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
ELISA 5 Antibodies 8 Antibodies 32 Antibodies
Immunocytochemistry (ICC) 1 Antibodies 1 Antibodies 3 Antibodies
Immunofluorescence (IF) 4 Antibodies 4 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies 1 Antibodies
Immunohistochemistry (IHC) 7 Antibodies 7 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 2 Antibodies 2 Antibodies
Western Blotting (WB) 9 Antibodies 14 Antibodies

General

Antigen Drebrin-Like (DBNL) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(57), (16), (9), (3), (2), (1), (1), (1), (1)
Host Rabbit
(35), (16), (6)
Clonality
Polyclonal
Conjugate This DBNL antibody is un-conjugated
(3), (3), (3), (3), (3), (3)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(49), (32), (12), (9), (4), (3), (2), (1)
Supplier Log in to see

Product Details anti-DBNL Antibody

Target Details DBNL Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:INWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQ
Isotype IgG

Target Details DBNL

Product Details anti-DBNL Antibody Application Details Handling Images back to top
Antigen
Alternative Name HIP-55 (DBNL Antibody Abstract)
Background Gene Symbol: DBNL
Gene ID 28988
Pathways TCR Signaling, Regulation of Actin Filament Polymerization

Application Details

Product Details anti-DBNL Antibody Target Details DBNL Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-DBNL Antibody Target Details DBNL Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-DBNL Antibody Target Details DBNL Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-DBNL antibody (Drebrin-Like) (ABIN4317498) Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human tonsi...
Western Blotting (WB) image for anti-DBNL antibody (Drebrin-Like) (ABIN4317498) Western Blot: HIP-55 Antibody [NBP1-91988] - Lane 1: NIH-3T3 cell lysate (Mouse embry...
Western Blotting (WB) image for anti-DBNL antibody (Drebrin-Like) (ABIN4317498) Western Blot: HIP-55 Antibody [NBP1-91988] - Lane 1: Marker [kDa] 230, 130, 95, 72, 5...