anti-Human SH2B3 antibody for Immunocytochemistry

Recommended SH2B3 Antibody (supplied by: Log in to see )

Antigen
SH2B Adaptor Protein 3 (SH2B3) Antibodies
  • LNK
  • IDDM20
  • AI429800
  • Lnk
  • SH2B adaptor protein 3
  • SH2B3
  • Sh2b3
Reactivity
Human
67
24
22
2
Host
Rabbit
32
20
17
Clonality
Polyclonal
Conjugate
This SH2B3 antibody is un-conjugated
3
3
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
53
20
17
14
13
8
6
3
2
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4331277
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1859674 ICC IHC IP WB Rabbit IgG AA 335-561 Log in to see Polyclonal
1 ABIN4331278 FACS ICC IF IHC IHC (p) WB Mouse IgG1 Log in to see 2D8

General

Antigen SH2B Adaptor Protein 3 (SH2B3) Antibodies
Reactivity Human
(67), (24), (22), (2)
Host Rabbit
(32), (20), (17)
Clonality
Polyclonal
Conjugate This SH2B3 antibody is un-conjugated
(3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(53), (20), (17), (14), (13), (8), (6), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-SH2B3 Antibody

Target Details SH2B3 Application Details Handling References for anti-SH2B3 antibody (ABIN4331277) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLSCYPWFH
Isotype IgG

Target Details SH2B3

Product Details anti-SH2B3 Antibody Application Details Handling References for anti-SH2B3 antibody (ABIN4331277) Images back to top
Antigen
Alternative Name LNK/SH2B3 (SH2B3 Antibody Abstract)
Background Gene Symbol: SH2B3
Gene ID 10019

Application Details

Product Details anti-SH2B3 Antibody Target Details SH2B3 Handling References for anti-SH2B3 antibody (ABIN4331277) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20-1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-SH2B3 Antibody Target Details SH2B3 Application Details References for anti-SH2B3 antibody (ABIN4331277) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-SH2B3 antibody (ABIN4331277)

Product Details anti-SH2B3 Antibody Target Details SH2B3 Application Details Handling Images back to top
Product cited in:

Flister, Endres, Rudemiller, Sarkis, Santarriaga, Roy, Lemke, Geurts, Moreno, Ran, Tsaih, De Pons, Carlson, Tan, Fahrenkrug, Lazarova, Lazar, North, LaViolette, Dwinell, Shull, Jacob: "CXM: a new tool for mapping breast cancer risk in the tumor microenvironment." in: Cancer research, Vol. 74, Issue 22, pp. 6419-29, 2014 (Sample species: Rat (Rattus)). Further details: Immunohistochemistry

Images

Product Details anti-SH2B3 Antibody Target Details SH2B3 Application Details Handling References for anti-SH2B3 antibody (ABIN4331277) back to top
Supplier Images
Immunofluorescence (IF) image for anti-SH2B Adaptor Protein 3 (SH2B3) antibody (ABIN4331277) Immunocytochemistry/Immunofluorescence: LNK Antibody [NBP1-87867] - Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SH2B Adaptor Protein 3 (SH2B3) antibody (ABIN4331277) Immunohistochemistry-Paraffin: LNK Antibody [NBP1-87867] - Staining of human lymph no...
Western Blotting (WB) image for anti-SH2B Adaptor Protein 3 (SH2B3) antibody (ABIN4331277) Western Blot: LNK Antibody [NBP1-87867] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, ...
Immunofluorescence (IF) image for anti-SH2B Adaptor Protein 3 (SH2B3) antibody (ABIN4331277) Immunocytochemistry/Immunofluorescence: LNK/SH2B3 Antibody - Immunofluorescent stain...