You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Xenopus laevis TCF4 antibody for Western Blotting

Recommended TCF4 Antibody (supplied by: Log in to see )

Antigen
Transcription Factor 4 (TCF4) Antibodies
  • 5730422P05Rik
  • ASP-I2
  • bHLHb19
  • E2-2
  • e2-A
  • E2.2
  • GE2
  • ITF-2
  • ITF-2b
  • ITF2
  • ME2
  • MITF-2A
  • MITF-2B
  • mTcf-4B
  • mTcf-4E
  • PTHS
  • SEF-2
  • SEF2
  • SEF2-1
  • SEF2-1A
  • SEF2-1B
  • Tcf-4
  • TCF-4
  • tcf-4
  • TCF4
  • Tcf4
  • TCF4B
  • TCF4E
  • TCF7L2
  • TFE
  • XE2
  • Xtcf-4
  • Xtcf4
Epitope
N-Term
23
15
5
4
3
3
2
2
2
1
1
1
1
1
Reactivity
Chicken, Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish
81
18
11
3
1
1
Host
Rabbit
57
15
9
Clonality
Polyclonal
Conjugate
This TCF4 antibody is un-conjugated
3
3
3
3
3
3
Application
Western Blotting (WB)
74
41
21
18
12
11
7
4
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN2792579
$ 289.00
Plus shipping costs $45.00

Top referenced anti-TCF4 antibody for Western Blotting

Similar anti-TCF4 Antibodies

Application / Reactivity Chicken Cow (Bovine) Dog (Canine) Human Mouse (Murine) Rat (Rattus) Xenopus laevis Zebrafish
Western Blotting (WB) 1 Antibodies 2 Antibodies 4 Antibodies 75 Antibodies 19 Antibodies 12 Antibodies 1 Antibodies 1 Antibodies
Immunoprecipitation (IP) 12 Antibodies 3 Antibodies 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 7 Antibodies 3 Antibodies
Immunohistochemistry (IHC) 7 Antibodies 6 Antibodies 11 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies 1 Antibodies
Immunofluorescence (IF) 21 Antibodies 4 Antibodies

General

Antigen Transcription Factor 4 (TCF4) Antibodies
Epitope N-Term
(23), (15), (5), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity Chicken, Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish
(81), (18), (11), (3), (1), (1)
Host Rabbit
(57), (15), (9)
Clonality
Polyclonal
Conjugate This TCF4 antibody is un-conjugated
(3), (3), (3), (3), (3), (3)
Application Western Blotting (WB)
(74), (41), (21), (18), (12), (11), (7), (4), (2), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-TCF4 Antibody

Target Details TCF4 Application Details Handling References for anti-TCF4 Antibody (ABIN2792579) Images
Sequence MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSL ASGHFTGSNV
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %
Purification Affinity Purified
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TCF4

Target Details TCF4

Product Details anti-TCF4 Antibody Application Details Handling References for anti-TCF4 Antibody (ABIN2792579) Images back to top
Antigen
Alternative Name TCF4 (TCF4 Antibody Abstract)
Background TCF4 encodes transcription factor 4, a basic helix-turn-helix transcription factor. The protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. TCF4 is expressed predominantly in pre-B-cells, although it is found in other tissues as well.
Molecular Weight 71 kDa
Gene ID 6925
NCBI Accession NM_003199, NP_003190
UniProt P15884
Research Area Stem Cells, Wnt, Transcription Factors
Pathways WNT Signaling

Application Details

Product Details anti-TCF4 Antibody Target Details TCF4 Handling References for anti-TCF4 Antibody (ABIN2792579) Images back to top
Application Notes WB Suggested Anti-TCF4 Antibody Titration: 0.2-1 µg/mL
Positive Control: Human Placenta.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 667 AA

Restrictions For Research Use only

Handling

Product Details anti-TCF4 Antibody Target Details TCF4 Application Details References for anti-TCF4 Antibody (ABIN2792579) Images back to top
Format Liquid
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C,-20 °C
Storage Comment For short term use, store at 2-8 °C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

References for anti-TCF4 Antibody (ABIN2792579)

Product Details anti-TCF4 Antibody Target Details TCF4 Application Details Handling Images back to top
Background publications

Lu, Sheng, Mo, Li, Wu, Shen: "A negative regulatory element-dependent inhibitory role of ITF2B on IL-2 receptor alpha gene." in: Biochemical and biophysical research communications, Vol. 336, Issue 1, pp. 142-9, 2005

Images

Product Details anti-TCF4 Antibody Target Details TCF4 Application Details Handling References for anti-TCF4 Antibody (ABIN2792579) back to top
Supplier Images
Western Blotting (WB) image for anti-TCF4 antibody (Transcription Factor 4) (N-Term) (ABIN2792579) WB Suggested Anti-TCF4 Antibody Titration: 0.2-1 ug/ml
Positive Control:...
Western Blotting (WB) image for anti-TCF4 antibody (Transcription Factor 4) (N-Term) (ABIN2792579) Host: Rabbit
Target Name: TCF4
Sample Tissue: HT1080 Whole Cell lysates...