PLAC9 antibody (AA 23-97)
-
- Target See all PLAC9 Antibodies
- PLAC9 (Placenta-Specific 9 (PLAC9))
-
Binding Specificity
- AA 23-97
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLAC9 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)
- Purpose
- Polyclonal Antibody to Placenta Specific Protein 9 (PLAC9)
- Sequence
- MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-AEPFSPPR GDSAQSTACD RHMAVQRRLD VMEEMVEKTV DHLGTEVKGL LGLLEELAWN LPPGPFSPAP DLLGDGF
- Specificity
- The antibody is a rabbit polyclonal antibody raised against PLAC9. It has been selected for its ability to recognize PLAC9 in immunohistochemical staining and western blotting.
- Purification
- Antigen-specific affinity chromatography followed by Protein A affinity chromatography
- Immunogen
-
Recombinant PLAC9 expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against PLAC9. - Isotype
- IgG
- Top Product
- Discover our top product PLAC9 Primary Antibody
-
-
- Application Notes
- Western blotting: 0.2-2 μg/mL,1:250-2500 Immunohistochemistry: 5-20 μg/mL,1:25-100 Immunocytochemistry: 5-20 μg/mL,1:25-100 Optimal working dilutions must be determined by end user.
- Comment
-
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- 500 μg/mL
- Buffer
- PBS, pH 7.4, containing 0.02 % Sodium azide, 50 % glycerol.
- Preservative
- Sodium azide
- Precaution of Use
- WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
- Handling Advice
- Avoid repeated freeze/thaw cycles
- Storage
- 4 °C,-20 °C
- Storage Comment
- Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
- Expiry Date
- 12 months
-
- Target
- PLAC9 (Placenta-Specific 9 (PLAC9))
- Alternative Name
- PLAC9 (PLAC9 Products)
-