TSHB antibody (AA 20-134)

Catalog No. ABIN1078576

This Rabbit Polyclonal antibody specifically detects TSHB in WB, IHC, ICC and IP. It exhibits reactivity toward Chicken.

Quick Overview for TSHB antibody (AA 20-134) (ABIN1078576)

Target: TSHB (Thyroid Stimulating Hormone, beta (TSHB))

Reactivity: Chicken

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSHB antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunoprecipitation (IP)

Product Details anti-TSHB Antibody

Binding Specificity: AA 20-134

Purpose: Polyclonal Antibody to Thyroid Stimulating Hormone Beta (TSHb)

Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGSEF-S VCAPSEYTIH VEKRECAYCL AINTTICAGF CMTRDSNGKK LLLKSALSQN VCTYKEMFYQ TALIPGCPHH TIPYYSYPVA ISCKCGKCNT DYSDCVHEKV RTNYCTKPQK LCNM

Specificity: The antibody is a rabbit polyclonal antibody raised against TSHb. It has been selected for its ability to recognize TSHb in immunohistochemical staining and western blotting.

Purification: Antigen-specific affinity chromatography followed by Protein A affinity chromatography

Immunogen: RPD213Ga01Recombinant Thyroid Stimulating Hormone Beta (TSHb)

Isotype: IgG

Application Details

Application Notes: Western blotting: 0.5-2 μg/mL,Immunohistochemistry: 5-20 μg/mL,Immunocytochemistry: 5-20 μg/mL,Optimal working dilutions must be determined by end user.

Comment:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 500 μg/mL

Buffer: 0.01M PBS, pH 7.4, containing 0.05 % Proclin-300, 50 % glycerol.

Preservative: ProClin

Precaution of Use: WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.

Handling Advice: Avoid repeated freeze/thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Expiry Date: 12 months

Target Details for TSHB

Target: TSHB (Thyroid Stimulating Hormone, beta (TSHB))

Alternative Name: TSHb

Background: TSH-B, Thyrotropin beta chain, Thyrotropin alfa

Pathways: Thyroid Hormone Synthesis, Peptide Hormone Metabolism