PTH antibody (AA 1-34)

Catalog No. ABIN109748

This Rabbit Polyclonal antibody specifically detects PTH in RIA. It exhibits reactivity toward Human.

Quick Overview for PTH antibody (AA 1-34) (ABIN109748)

Target: PTH (Parathyroid Hormone (PTH))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTH antibody is un-conjugated

Application: Radioimmunoassay (RIA)

Product Details anti-PTH Antibody

Binding Specificity: AA 1-34

Specificity: Human PTH (aa 1-34)

Purification: Purified

Immunogen: Synthetic human PTH (aa 1-34), bTG- conjugated (svseiqlmhnlgkhlnsmervewlrkklqdvhnf)

Application Details

Application Notes: RIA (1/10,000) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Storage: 4 °C

Target Details for PTH

Target: PTH (Parathyroid Hormone (PTH))

Alternative Name: Parathyroid Hormone

Target Type: Hormone

Background: Serum

Gene ID: 5741

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process