PTH antibody (AA 1-34)

Catalog No. ABIN109756

The Rabbit Polyclonal anti-PTH antibody (ABIN109756) specifically detects PTH in ELISA. The antibody is reactive with Human samples.

Quick Overview for PTH antibody (AA 1-34) (ABIN109756)

Target: PTH (Parathyroid Hormone (PTH))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTH antibody is un-conjugated

Application: ELISA

Product Details anti-PTH Antibody

Binding Specificity: AA 1-34

Specificity: Human PTH (aa 15-25 1-34 1-38 1-84 7-84) There were no cross reactivities obtained with synthetic human PTH (aa 1-10)

Immunogen: Synthetic human PTH (aa 1-34), bTG- conjugated (svseiqlmhnlgkhlnsmervewlrkklqdvhnf)

Application Details

Application Notes: ELISA (1/3000)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Storage: 4 °C

Target Details for PTH

Target: PTH (Parathyroid Hormone (PTH))

Alternative Name: Parathyroid Hormone

Target Type: Hormone

Background: Serum

Gene ID: 5741

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process