PTH antibody (AA 1-34)

Catalog No. ABIN109766

This Goat Polyclonal antibody specifically detects PTH in RIA. It exhibits reactivity toward Rat.

Quick Overview for PTH antibody (AA 1-34) (ABIN109766)

Target: PTH (Parathyroid Hormone (PTH))

Reactivity: Rat

Host: Goat

Clonality: Polyclonal

Conjugate: This PTH antibody is un-conjugated

Application: Radioimmunoassay (RIA)

Product Details anti-PTH Antibody

Binding Specificity: AA 1-34

Specificity: Rat PTH (aa 1-34) There were no cross reactivities obtained with rat PTH (aa 53-84)

Purification: Purified

Immunogen: Synthetic rat PTH aa (1-34) bTG- conjugated (avseiqlmhnlgkhlasvermqwlrkklqdvhnf)

Application Details

Application Notes: RIA (1/2,000)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Storage: 4 °C

Target Details for PTH

Target: PTH (Parathyroid Hormone (PTH))

Alternative Name: Parathyroid Hormone

Target Type: Hormone

Background: Serum

Gene ID: 24694

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process