PRO-ANP antibody (AA 1-30)
-
- Target See all PRO-ANP Antibodies
- PRO-ANP (Pro-Atrial Natriuretic Peptide (PRO-ANP))
-
Binding Specificity
- AA 1-30
-
Reactivity
- Human
-
Host
-
Sheep
-
Clonality
- Polyclonal
-
Conjugate
- This PRO-ANP antibody is un-conjugated
-
Application
- ELISA, Radioimmunoassay (RIA)
- Specificity
- Synthetic human pro-ANP (aa 1-30) There were no cross reactivities obtained with human pro-ANP (aa 31-67, 67-98) and human ANP (aa 1-28)
- Immunogen
- Synthetic human pro-ANP (aa 1-30) poly Lysin conjugated (npmynavsnadlmdfknlldhleekmpled)
- Top Product
- Discover our top product PRO-ANP Primary Antibody
-
-
- Application Notes
- RIA (1/5000) ELISA This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Resuspend in aqua bidest.
- Storage
- 4 °C
-
- Target
- PRO-ANP (Pro-Atrial Natriuretic Peptide (PRO-ANP))
- Alternative Name
- Pro-Atrial Natriuretic Peptide (PRO-ANP Products)
- Background
- Serum
- Gene ID
- 4878
-