PTH antibody (AA 1-38)

Catalog No. ABIN110062

The Mouse Monoclonal anti-PTH antibody (Clone A1-70) (ABIN110062) specifically detects PTH in ELISA, RIA and IHC (fro). The antibody is reactive with Human samples.

Quick Overview for PTH antibody (AA 1-38) (ABIN110062)

Target: PTH (Parathyroid Hormone (PTH))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This PTH antibody is un-conjugated

Application: ELISA, Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro))

Clone: A1-70

Product Details anti-PTH Antibody

Binding Specificity: AA 1-38

Specificity: Human PTH peptide (aa 15-25; 1-34; 1-38; 1-84; 7-84) There were no cross reactivities obtained with synthetic human PTH (aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84) and PTHrP (aa 1-86)

Purification: Purified

Immunogen: Synthetic human PTH (aa 1-38) poly Lysin conjugated (svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalg)

Application Details

Application Notes: RIA (20 ng/ml) Immunohistochemistry (cryo-sections and paraffin sections 2 microg/ml) ELISA (1microg/ml)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Storage: 4 °C

Target Details for PTH

Target: PTH (Parathyroid Hormone (PTH))

Alternative Name: Parathyroid Hormone

Target Type: Hormone

Background: Cell supernatant, Prot. A purified 0,01 M sodiumphosphate, 0,15 M sodium chloride pH 7,2

Gene ID: 5741

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process