ZNF76 antibody (Middle Region)

Catalog No. ABIN1109607

This anti-ZNF76 antibody is a Rabbit Polyclonal antibody detecting ZNF76 in WB. Suitable for Human, Mouse, Rat, Dog, Cow and Pig.

Quick Overview for ZNF76 antibody (Middle Region) (ABIN1109607)

Target: ZNF76 (Zinc Finger Protein 76 (Expressed in Testis) (ZNF76))

Reactivity: Human, Mouse, Rat, Dog, Cow, Pig

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZNF76 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZNF76 Antibody

Binding Specificity: Middle Region

Sequence: MHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPRIAYLSEVK

Cross-Reactivity (Details): Species reactivity (expected):Mouse, Rat, Pig, Bovine, DogSpecies reactivity (tested):Human

Purification: Purified using peptide immunoaffinity column

Immunogen: The immunogen for anti-ZNF76 antibody: synthetic peptide directed towards the middle region of human ZNF76

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Reconstitution: Add 50 μL of distilled water to a final concentration of 1 mg/mL.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.

Target Details for ZNF76

Target: ZNF76 (Zinc Finger Protein 76 (Expressed in Testis) (ZNF76))

Alternative Name: ZNF76

Background: ZNF76 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers. ZNF76 may be involved in transcriptional regulation.Synonyms: D6S229E, ZNF523, Zinc finger protein 523, Zinc finger protein 76

Gene ID: 7629

NCBI Accession: NP_003418