ABCC9 antibody (AA 1505-1546)
-
- Target See all ABCC9 Antibodies
- ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))
-
Binding Specificity
- AA 1505-1546
-
Reactivity
- Mouse
-
Host
- Mouse
-
Clonality
- Monoclonal
-
Conjugate
- This ABCC9 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF)
- Specificity
- Detects ~120 kDa. Does not cross-react with SUR2B.
- Cross-Reactivity
- Human, Mouse, Rat
- Purification
- Protein G Purified
- Immunogen
- Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
- Clone
- S319A-14
- Isotype
- IgG2a
-
-
- Application Notes
-
- WB (1:1000)
- optimal dilutions for assays should be determined by the user.
- Comment
-
1 μg/ml of ABIN1686640 was sufficient for detection of SUR2A in 20 μg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- 1 mg/mL
- Buffer
- PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide, Storage buffer may change when conjugated
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- -20 °C
- Storage Comment
- -20°C
-
- Target
- ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))
- Alternative Name
- SUR2A (ABCC9 Products)
- Background
- Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).
- Gene ID
- 20928
- NCBI Accession
- NP_001038185
- UniProt
- P70170
-