ABCC9 antibody (AA 1505-1546) (PerCP)

Catalog No. ABIN2482982

The PerCP-conjugated Mouse Monoclonal anti-ABCC9 antibody (Clone S319A-14) (ABIN2482982) specifically detects ABCC9 in WB, IHC, ICC and IF. The antibody is reactive with Mouse samples.

Quick Overview for ABCC9 antibody (AA 1505-1546) (PerCP) (ABIN2482982)

Target: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Reactivity: Mouse

Host: Mouse

Clonality: Monoclonal

Conjugate: This ABCC9 antibody is conjugated to PerCP

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF)

Clone: S319A-14

Product Details anti-ABCC9 Antibody (PerCP)

Binding Specificity: AA 1505-1546

Specificity: Detects ~120 kDa. Does not cross-react with SUR2B.

Cross-Reactivity: Human, Mouse, Rat

Purification: Protein G Purified

Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A

Isotype: IgG2a

Application Details

Application Notes:

• WB (1:1000)
• optimal dilutions for assays should be determined by the user.

Comment:

1 μg/ml of ABIN2482982 was sufficient for detection of SUR2A in 20 μg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 1 mg/mL

Buffer: PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide, Storage buffer may change when conjugated

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C

Storage Comment: Conjugated antibodies should be stored at 4°C

Target Details for ABCC9

Target: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Alternative Name: SUR2A

Background: Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).

Gene ID: 20928

NCBI Accession: NP_001038185

UniProt: P70170