NMS antibody (AA 70-103)

Catalog No. ABIN1831479

This anti-NMS antibody is a Rabbit Polyclonal antibody detecting NMS in ELISA. Suitable for Mouse.

Quick Overview for NMS antibody (AA 70-103) (ABIN1831479)

Target: NMS (Neuromedin S (NMS))

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NMS antibody is un-conjugated

Application: ELISA

Product Details anti-NMS Antibody

Binding Specificity: AA 70-103

Specificity: Mouse Neuromedin S.

Purification: Protein A purified

Immunogen: Synthetic peptide corresponding to aa70-103 of mouse prepro-Neuromedin S (FLFHYSRTRKPTHPVSAEFAPVHPLMRLAAKLAS).

Type of Immunogen: Synthetic peptide

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Mouse

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: PBS

Concentration: Lot specific

Buffer: Lyophilized from PBS,  pH 7

Handling Advice: Aliquot to avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C.

Target Details for NMS

Target: NMS (Neuromedin S (NMS))

Alternative Name: NMS

Background: Name/Gene ID: NMS

Synonyms: NMS, FLGRACILE, Neuromedin-S, Neuromedin S, PTD, BJS

Gene ID: 129521

UniProt: Q5H8A3