NPPB antibody (N-Term)

Catalog No. ABIN191931

The Mouse Monoclonal anti-NPPB antibody has been validated for EIA. It is suitable to detect NPPB in samples from Human.

Quick Overview for NPPB antibody (N-Term) (ABIN191931)

Target: NPPB (Natriuretic Peptides B (NPPB))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This NPPB antibody is un-conjugated

Application: Enzyme Immunoassay (EIA)

Clone: 01-03-21

Product Details anti-NPPB Antibody

Binding Specificity: AA 1-32, N-Term

Specificity: This antibody detects synthetic BNP (aa 1-32) and recombinant proBNP (aa 1-108).

Purification: Protein G chromatography

Immunogen: Synthetic human BNP (aa 1-32) KLH conjugatedAA Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Isotype: IgG2b

Application Details

Application Notes: ELISA.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Restrictions: For Research Use only

Handling

Reconstitution: Restore in aqua bidest to 1 mg/mL.

Buffer: PBS pH 7,4

Storage: 4 °C/-20 °C

Storage Comment: Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing.
Shelf life: One year from despatch.

Expiry Date: 12 months

Target Details for NPPB

Target: NPPB (Natriuretic Peptides B (NPPB))

Alternative Name: Natriuretic Peptides B

Background: In cardiac tissue brain natriuretic peptide (BNP) is synthesized as 134 amino acid precursor (prepro-BNP), which is cleaved by proteases to form a 26 aa "signal" peptide and a 108 aa pro-BNP. Proteolytic digestion of pro-BNP results in formation of 76 aa amino-terminal NT-proBNP and biologically active 32 aa BNP hormone molecule. Both proBNP and NTproBNP circulate in human plasma and have been proposed as markers for early diagnosis of left ventricular dysfunction as well as prognostic markers of possible cardiac complications at patients with heart failure.

Gene ID: 4879

UniProt: P16860

Pathways: Hormone Activity