PTH antibody (N-Term)

Catalog No. ABIN191937

This anti-PTH antibody is a Rat Monoclonal antibody detecting PTH in IHC (p), IHC (fro) and EIA. Suitable for Human.

Quick Overview for PTH antibody (N-Term) (ABIN191937)

Target: PTH (Parathyroid Hormone (PTH))

Reactivity: Human

Host: Rat

Clonality: Monoclonal

Conjugate: This PTH antibody is un-conjugated

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro)), Enzyme Immunoassay (EIA)

Clone: 3B3

Product Details anti-PTH Antibody

Binding Specificity: AA 1-34, N-Term

Specificity: This antibody detects Human oxidized PTH (aa 1-34), native PTH in tissue sections and in circulation. Cross reacts with native PTH (aa 1-84).

Characteristics: Synonyms: Parathormone, Parathyrin

Purification: Protein A Chromatography

Immunogen: Synthetic human PTH (aa 1-34) BSA conjugated. AA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Isotype: IgG2b

Application Details

Application Notes: ELISA. Immunohistochemistry (Cryo-Sections and Paraffin-Sections): 1/25-50.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Restrictions: For Research Use only

Handling

Reconstitution: Restore in aqua bidest to 1 mg/mL.

Buffer: PBS, pH 7.4 without preservatives

Preservative: Without preservative

Storage: 4 °C/-20 °C

Storage Comment: Store the antibody lyophilized at 2-8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch.

Expiry Date: 12 months

Target Details for PTH

Target: PTH (Parathyroid Hormone (PTH))

Alternative Name: Parathyroid Hormone / PTH

Target Type: Hormone

Background: Parathyroid hormone (PTH), or Parathormone, is secreted by the parathyroid glands as a polypeptide containing 84 amino acids. It acts to increase the concentration of calcium in the blood, whereas calcitonin (a hormone produced by the parafollicular cells of the thyroid gland) acts to decrease calcium concentration.Synonyms: Parathormone, Parathyrin

Gene ID: 5741

UniProt: P01270

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process