Ataxin 1 antibody (AA 164-197)

Catalog No. ABIN1976879

The Mouse Monoclonal anti-Ataxin 1 antibody has been validated for WB, IHC and IP. It is suitable to detect Ataxin 1 in samples from Human, Mouse and Rat.

Quick Overview for Ataxin 1 antibody (AA 164-197) (ABIN1976879)

Target: Ataxin 1 (ATXN1)

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This Ataxin 1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)

Clone: S76-8

Product Details anti-Ataxin 1 Antibody

Binding Specificity: AA 164-197

Specificity: Detects a 85 kD protein.

Purification: Protein G purified from tissue culture supernatant

Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis: Mouse, Rat (100%).

Type of Immunogen: Synthetic peptide

Isotype: IgG2b

Application Details

Application Notes: Approved: IHC, IP, WB (1:1000)

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: PBS,  pH 7.4, 0.1 % sodium azide, 50 % glycerol.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: Store at -20°C.

Target Details for Ataxin 1

Target: Ataxin 1 (ATXN1)

Alternative Name: ATXN1 / Ataxin-1 / SCA1

Background: Name/Gene ID: ATXN1

Synonyms: ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1

Gene ID: 6310

Pathways: Synaptic Membrane