beta Endorphin antibody (AA 1-31)
-
- Target See all beta Endorphin (beta-EP) Antibodies
- beta Endorphin (beta-EP) (Endorphin beta (beta-EP))
-
Binding Specificity
- AA 1-31
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This beta Endorphin antibody is un-conjugated
-
Application
- Immunohistochemistry (IHC), Immunofluorescence (IF), Radioimmunoassay (RIA)
- Sequence
- YGGFMTSEKS QTPLVTLFKN AIIKNAYKKG E
- Cross-Reactivity
- Human, Mouse (Murine), Rat (Rattus)
- Cross-Reactivity (Details)
- Calculated cross reactivity: Hu Mo Rt
- Characteristics
- Endorphin, beta (B-Endorphin, Pro-opiomelanocortin, POMC)
- Purification
- Purified
- Immunogen
- Synthetic human beta-endorphin peptide corresponding to aa1-31, conjugated to BSA. Sequence: YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
- Top Product
- Discover our top product beta-EP Primary Antibody
-
-
- Application Notes
- Optimal working conditions should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Reconstitute with 500 μL PBS, pH 7.4.
- Buffer
- Supplied as a lyophilized powder in BSA.
- Storage
- -20 °C
- Storage Comment
- -20°C
-
- Target
- beta Endorphin (beta-EP) (Endorphin beta (beta-EP))
- Alternative Name
- Endorphin, beta (beta-EP Products)
- Synonyms
- ACTH antibody, BE antibody, Beta-LPH antibody, Clip antibody, Gamma-LPH antibody, Npp antibody, Pomc-1 antibody, Pomc1 antibody, alpha-MSH antibody, alphaMSH antibody, beta-MSH antibody, gamma-MSH antibody, CLIP antibody, LPH antibody, MSH antibody, NPP antibody, POC antibody, pro-opiomelanocortin-alpha antibody, proopiomelanocortin antibody, Pomc antibody, POMC antibody
- UniProt
- P01189
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Peptide Hormone Metabolism, Hormone Activity
-