Integrin alpha 3a antibody (Cytoplasmic Domain)

Catalog No. ABIN2295550

This Mouse Monoclonal antibody specifically detects Integrin alpha 3a in IHC, WB and IC. It exhibits reactivity toward Human.

Quick Overview for Integrin alpha 3a antibody (Cytoplasmic Domain) (ABIN2295550)

Target: Integrin alpha 3a

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This Integrin alpha 3a antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunochromatography (IC)

Clone: 29A3

Product Details anti-Integrin alpha 3a Antibody

Binding Specificity: Cytoplasmic Domain

Sequence: CRTRALYEAK RQKAEMKSQP SETERLTDDY

Cross-Reactivity: Human

Cross-Reactivity (Details): Calculated cross reactivity: Hu

Characteristics: Integrin alpha 3A

Purification: Purified by Protein G affinity chromatography.

Immunogen: Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Isotype: IgG1

Application Details

Application Notes: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: -20°C

Target Details for Integrin alpha 3a

Target: Integrin alpha 3a