Integrin alpha 3b antibody (N-Term)

Catalog No. ABIN2295556

This Mouse Monoclonal antibody specifically detects Integrin alpha 3b in IHC, WB and IC. It exhibits reactivity toward Human.

Quick Overview for Integrin alpha 3b antibody (N-Term) (ABIN2295556)

Target: Integrin alpha 3b

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This Integrin alpha 3b antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunochromatography (IC)

Clone: 54B3

Product Details anti-Integrin alpha 3b Antibody

Binding Specificity: N-Term

Sequence: CTRYYQIMPK YHAVRIREEE RYPPPGSTLP TKK

Cross-Reactivity: Human

Cross-Reactivity (Details): Calculated cross reactivity: Hu

Characteristics: Integrin alpha 3B

Purification: Purified by Protein G affinity chromatography.

Immunogen: Synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to KLH

Isotype: IgG1

Application Details

Application Notes: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: -20°C

Target Details for Integrin alpha 3b

Target: Integrin alpha 3b