PTGIS antibody (AA 299-329)

Catalog No. ABIN2451653

Product Details anti-PTGIS Antibody

Target: PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))

Binding Specificity: AA 299-329

Reactivity: Cow

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTGIS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunoprecipitation (IP)

Specificity: Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)1,2,3

Cross-Reactivity: Human, Rat (Rattus), Sheep (Ovine)

Predicted Reactivity: Percent identity by BLAST analysis: Bovine (100%) Horse, Pig (87%) Gibbon, Monkey, Bat (83%) Human (80%).

Purification: Immunoaffinity Chromatography

Immunogen: Bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT).

Isotype: IgG

Application Details

Application Notes: IHC-P (5 µg/mL), IP, WB

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: TBS, pH 7.4, 0.5% BSA, 0.02% sodium azide, 50% glycerol.

Preservative: Sodium azide

Precaution of Use: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeat freeze-thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Long term: -20°C, Short term: +4°C, Avoid freeze-thaw cycles.

Target Details for PTGIS

Target: PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))

Alternative Name: PGIS / PTGIS (PTGIS Products)

Background: Standard Gene Symbol: PTGIS, Synonyms: PTGIS, CYP8A1, Prostaglandin I2 synthase, Prostacyclin synthase, PTGI, CYP8, PGIS

Gene ID: 5740

UniProt: Q16647