Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (AA 299-329) antibody

Details for Product No. ABIN2451653
Antigen
  • CYP8
  • CYP8A1
  • PGIS
  • PTGI
  • Cyp8
  • Cyp8a1
  • Pgis
  • ptgisl
  • PTGIS
  • prostaglandin I2 synthase
  • prostaglandin I2 (prostacyclin) synthase
  • prostacyclin synthase
  • PTGIS
  • Ptgis
  • ptgis
  • VDBG_06319
Epitope
AA 299-329
7
4
4
4
3
3
2
2
2
2
1
1
1
1
1
1
Reactivity
Cow (Bovine)
51
29
16
7
4
2
2
2
1
1
1
1
1
1
Host
Rabbit
44
12
2
1
Clonality
Polyclonal
Conjugate
Un-conjugated
3
2
2
2
2
2
2
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunoprecipitation (IP), Western Blotting (WB)
41
21
15
9
7
3
2
2
2
1
1
Options
Immunogen Bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT).
Isotype IgG
Specificity Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)1,2,3
Cross-Reactivity Human, Rat (Rattus), Sheep (Ovine)
Predicted Reactivity Percent identity by BLAST analysis: Bovine (100%) Horse, Pig (87%) Gibbon, Monkey, Bat (83%) Human (80%).
Purification Immunoaffinity Chromatography
Antigen
Alternative Name PGIS / PTGIS (PTGIS Antibody Abstract)
Background Standard Gene Symbol: PTGIS, Synonyms: PTGIS, CYP8A1, Prostaglandin I2 synthase, Prostacyclin synthase, PTGI, CYP8, PGIS
Gene ID 5740
UniProt Q16647
Application Notes IHC-P (5 µg/mL), IP, WB
Restrictions For Research Use only
Format Liquid
Concentration Lot specific
Buffer TBS, pH 7.4, 0.5% BSA, 0.02% sodium azide, 50% glycerol.
Preservative Sodium azide
Precaution of Use This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeat freeze-thaw cycles.
Storage 4 °C/-20 °C
Storage Comment Long term: -20°C, Short term: +4°C, Avoid freeze-thaw cycles.
Supplier Images
Image no. 1 for anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (AA 299-329) antibody (ABIN2451653) Human Prostate (formalin-fixed, paraffin-embedded) stained with PTGIS antibody ABIN21...
Did you look for something else?