Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (AA 299-329) antibody

Details for Product No. ABIN2451653
Target
Binding Specificity
AA 299-329
4
4
4
3
3
3
2
2
2
1
1
1
1
1
1
1
Reactivity
Cow
41
22
15
6
4
2
2
2
1
1
1
1
1
1
Host
Rabbit
34
10
2
1
Clonality
Polyclonal
Conjugate
Un-conjugated
3
2
1
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunoprecipitation (IP), Western Blotting (WB)
35
19
12
8
4
3
2
2
1
1
Options
Immunogen Bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT).
Isotype IgG
Specificity Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)1,2,3
Cross-Reactivity Human, Rat (Rattus), Sheep (Ovine)
Predicted Reactivity Percent identity by BLAST analysis: Bovine (100%) Horse, Pig (87%) Gibbon, Monkey, Bat (83%) Human (80%).
Purification Immunoaffinity Chromatography
Target
Alternative Name PGIS / PTGIS (PTGIS Antibody Abstract)
Background Standard Gene Symbol: PTGIS, Synonyms: PTGIS, CYP8A1, Prostaglandin I2 synthase, Prostacyclin synthase, PTGI, CYP8, PGIS
Gene ID 5740
UniProt Q16647
Application Notes IHC-P (5 µg/mL), IP, WB
Restrictions For Research Use only
Format Liquid
Concentration Lot specific
Buffer TBS, pH 7.4, 0.5% BSA, 0.02% sodium azide, 50% glycerol.
Preservative Sodium azide
Precaution of Use This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeat freeze-thaw cycles.
Storage 4 °C/-20 °C
Storage Comment Long term: -20°C, Short term: +4°C, Avoid freeze-thaw cycles.
Images
Image no. 1 for anti-Prostaglandin I2 (Prostacyclin) Synthase (PTGIS) (AA 299-329) antibody (ABIN2451653) Human Prostate (formalin-fixed, paraffin-embedded) stained with PTGIS antibody ABIN21...