PTGIS antibody (AA 299-329)

Catalog No. ABIN2451653

Product Details anti-PTGIS Antibody

Target: PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))

Binding Specificity: AA 299-329

Reactivity: Cow

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTGIS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunoprecipitation (IP)

Specificity: Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)1,2,3

Cross-Reactivity: Human, Rat (Rattus), Sheep (Ovine)

Predicted Reactivity: Percent identity by BLAST analysis: Bovine (100%) Horse, Pig (87%) Gibbon, Monkey, Bat (83%) Human (80%).

Purification: Immunoaffinity Chromatography

Immunogen: Bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT).

Isotype: IgG

Application Details

Application Notes: IHC-P (5 µg/mL), IP, WB

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: TBS, pH 7.4, 0.5% BSA, 0.02% sodium azide, 50% glycerol.

Preservative: Sodium azide

Precaution of Use: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeat freeze-thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Long term: -20°C, Short term: +4°C, Avoid freeze-thaw cycles.

Target Details for PTGIS

Target: PTGIS (Prostaglandin I2 (Prostacyclin) Synthase (PTGIS))

Alternative Name: PGIS / PTGIS (PTGIS Products)

Synonyms: CYP8 antibody, CYP8A1 antibody, PGIS antibody, PTGI antibody, Cyp8 antibody, Cyp8a1 antibody, Pgis antibody, ptgisl antibody, PTGIS antibody, prostaglandin I2 synthase antibody, prostaglandin I2 (prostacyclin) synthase antibody, prostacyclin synthase antibody, PTGIS antibody, Ptgis antibody, ptgis antibody, VDBG_06319 antibody

Background: Standard Gene Symbol: PTGIS, Synonyms: PTGIS, CYP8A1, Prostaglandin I2 synthase, Prostacyclin synthase, PTGI, CYP8, PGIS

Gene ID: 5740

UniProt: Q16647